KEGG   Kosmotoga olearia: Kole_0040Help
Entry
Kole_0040         CDS       T00914                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kol  Kosmotoga olearia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kole_0040
Enzymes [BR:kol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Kole_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(46655..47677)
Genome map
AA seq 340 aa AA seqDB search
MKTPELLIKLSNAFGPVGYEDEVRKIIQEEIEPYVDEVKVDNLGNLIAFKRGTGKKKVAF
FAHIDEVSLVVSAKDERGFLRFDTMGGIDPKVLIAQRVKVVSKDGKVRRGVIGVLAPHLQ
KAADRKNIPPMDEMFIDVSMNPDYEKIEIGDLVVIDTEAFESNGKVIGKALDDRACAVIS
ILVAKQLSKFSRFPDVYFVFTSREEVGGMGARVAAEAIQPDVGIAMDVTHAHKRTGIELG
KGPAITVGGPNIHKGYFKMLDDVAKREGVKVQYEIAAGRTGTDADNVQIAGTGIPALLVS
LPNKFMHTPVEVVQVSDVEESARLLVNFLFELEEGEENEA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacgcccgagctattgatcaagctatcaaatgcctttggccctgtgggttatgaa
gatgaggttagaaagatcatccaggaggagatcgaaccctatgtggatgaagtaaaagtc
gacaaccttggcaacctcattgccttcaaacgggggacaggcaagaaaaaagttgcattt
ttcgctcacatcgatgaagtctctcttgttgtttccgccaaagacgaaagaggtttttta
aggttcgataccatgggcgggatcgacccaaaagtcctcatcgctcaacgggtaaaggtt
gtatcaaaggacggcaaagtgcgacgaggagtcattggagtgcttgcgccacatctccag
aaagcagcagatcgcaaaaacataccgccaatggatgaaatgtttattgatgtttctatg
aatccggattatgagaaaatcgaaattggtgatcttgttgtgatagataccgaagctttt
gaaagtaatggaaaggttattggaaaagctcttgatgatagagcctgcgctgttatttct
atactcgttgcgaagcagctttcaaagttttcccgattcccggatgtgtacttcgttttt
acgagtcgcgaagaggtaggcggtatgggagccagagtggctgctgaggcgatacaacct
gatgttgggatagcgatggatgtaacccacgctcacaaaaggacaggaatagagctcggc
aaaggaccggcgataaccgtaggtggtccgaatatccacaaaggatacttcaaaatgctt
gatgatgtggcaaaacgcgaaggtgtcaaggttcaatacgaaatcgcagctgggaggacc
ggaacagatgccgataatgtccagatagccggtacgggaatcccggcgcttctggtgtcg
cttccaaataaattcatgcacactcctgtggaagtggtgcaggtatctgatgttgaagag
tctgcaagattactcgtgaacttcctttttgaattggaagaaggtgaagagaatgaagct
tga

DBGET integrated database retrieval system