KEGG   Kosmotoga olearia: Kole_0040Help
Entry
Kole_0040         CDS       T00914                                 

Definition
(GenBank) peptidase M42 family protein
Organism
kol  Kosmotoga olearia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(46655..47677)
Genome map
AA seq 340 aa AA seqDB search
MKTPELLIKLSNAFGPVGYEDEVRKIIQEEIEPYVDEVKVDNLGNLIAFKRGTGKKKVAF
FAHIDEVSLVVSAKDERGFLRFDTMGGIDPKVLIAQRVKVVSKDGKVRRGVIGVLAPHLQ
KAADRKNIPPMDEMFIDVSMNPDYEKIEIGDLVVIDTEAFESNGKVIGKALDDRACAVIS
ILVAKQLSKFSRFPDVYFVFTSREEVGGMGARVAAEAIQPDVGIAMDVTHAHKRTGIELG
KGPAITVGGPNIHKGYFKMLDDVAKREGVKVQYEIAAGRTGTDADNVQIAGTGIPALLVS
LPNKFMHTPVEVVQVSDVEESARLLVNFLFELEEGEENEA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacgcccgagctattgatcaagctatcaaatgcctttggccctgtgggttatgaa
gatgaggttagaaagatcatccaggaggagatcgaaccctatgtggatgaagtaaaagtc
gacaaccttggcaacctcattgccttcaaacgggggacaggcaagaaaaaagttgcattt
ttcgctcacatcgatgaagtctctcttgttgtttccgccaaagacgaaagaggtttttta
aggttcgataccatgggcgggatcgacccaaaagtcctcatcgctcaacgggtaaaggtt
gtatcaaaggacggcaaagtgcgacgaggagtcattggagtgcttgcgccacatctccag
aaagcagcagatcgcaaaaacataccgccaatggatgaaatgtttattgatgtttctatg
aatccggattatgagaaaatcgaaattggtgatcttgttgtgatagataccgaagctttt
gaaagtaatggaaaggttattggaaaagctcttgatgatagagcctgcgctgttatttct
atactcgttgcgaagcagctttcaaagttttcccgattcccggatgtgtacttcgttttt
acgagtcgcgaagaggtaggcggtatgggagccagagtggctgctgaggcgatacaacct
gatgttgggatagcgatggatgtaacccacgctcacaaaaggacaggaatagagctcggc
aaaggaccggcgataaccgtaggtggtccgaatatccacaaaggatacttcaaaatgctt
gatgatgtggcaaaacgcgaaggtgtcaaggttcaatacgaaatcgcagctgggaggacc
ggaacagatgccgataatgtccagatagccggtacgggaatcccggcgcttctggtgtcg
cttccaaataaattcatgcacactcctgtggaagtggtgcaggtatctgatgttgaagag
tctgcaagattactcgtgaacttcctttttgaattggaagaaggtgaagagaatgaagct
tga

DBGET integrated database retrieval system