KEGG   Kosmotoga olearia: Kole_0275Help
Entry
Kole_0275         CDS       T00914                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
kol  Kosmotoga olearia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kol00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
301518..302348
Genome map
AA seq 276 aa AA seqDB search
MKKLLARGRYLDLSETVVMGIINVTPDSFYTGSRYQGIEDAVKKAVEMYEEGAKILDIGG
ESSRPGADPVEPQEEIRRVVPVIKELRKLIPDCFISIDTYHPETAKAALDSGADIVNDIT
GLRNEKMMRLVYENNAGVILMHMKGTPKTMQNEPYYEDVVSEVKELLKANAEKAVEMGIP
SESIVIDPGIGFGKRFEDNLEILRKLDIFKKLGYSVLIGHSRKSFIGYILDLPPEERLEG
TLAVSAYCYLKNVEIIRVHDVREHIRLFKVLSALKN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagctcctggcaagaggtcgttatctcgacctttcagaaacagttgtaatggga
ataataaatgttaccccggactcgttctacaccggaagccgctatcagggcatagaagac
gctgttaaaaaagccgttgaaatgtatgaagaaggagcaaaaatactggatatcgggggc
gagtcgtcaagacctggagcagatccggtagaaccacaggaagagataagacgtgttgtt
cccgtaatcaaagagctaagaaaattaatacctgattgtttcatctcgatagatacttac
catccagagaccgcaaaagccgcactggatagcggtgcagatatagtgaacgatattacg
ggtttacgaaacgagaaaatgatgagattggtatatgaaaacaatgctggcgtgatttta
atgcacatgaagggaacgccaaaaacaatgcagaatgaaccatattacgaagatgttgta
agcgaggttaaagaattactcaaagccaatgcggaaaaagccgttgaaatgggtattcct
tcagaaagcatagtgattgatccgggtattggtttcggaaaaagattcgaagataacctg
gaaattttaagaaaacttgacatttttaagaaactcgggtattctgtactgatagggcac
tcaaggaaaagttttatagggtacatcctcgaccttccgccagaggaaaggcttgaaggc
acattggctgtttcggcatactgttatttgaaaaacgttgagattatcagggtccacgat
gtgagagagcatatcaggctgttcaaggttttaagtgcgttaaaaaactag

DBGET integrated database retrieval system