KEGG   Kosmotoga olearia: Kole_0380Help
Entry
Kole_0380         CDS       T00914                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00020  Citrate cycle (TCA cycle)
kol00620  Pyruvate metabolism
kol00640  Propanoate metabolism
kol00650  Butanoate metabolism
kol00680  Methane metabolism
kol01100  Metabolic pathways
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
Module
kol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_0380
   00020 Citrate cycle (TCA cycle)
    Kole_0380
   00620 Pyruvate metabolism
    Kole_0380
   00640 Propanoate metabolism
    Kole_0380
   00650 Butanoate metabolism
    Kole_0380
  Energy metabolism
   00680 Methane metabolism
    Kole_0380
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Kole_0380
Enzymes [BR:kol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Kole_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_9 Fer4_7 Fer4_6 Fer4_10 Fer4_16 Fer4_4 Fer4_2 Fer4_13 Fer4_8 Fer4_17 Fer4_15 Fer4_3 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACR79105
UniProt: C5CDT6
Position
397795..398091
Genome map
AA seq 98 aa AA seqDB search
MAQKGWKDIPIGGIIDTPGSAREYKTGTWRIMRPIWDVNKCINCMQCWLFCPDLAIIQND
AKMEGIDYDYCKGCGTCAAVCPKDAIEMRPETDFQGEE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaaggctggaaagatattccaataggcggaattattgacaccccgggttct
gctcgtgaatacaaaacaggtacatggagaataatgcgtcccatatgggatgttaacaaa
tgtataaattgtatgcaatgctggcttttctgccctgatcttgccatcattcaaaatgac
gccaaaatggaaggaatcgattacgattactgtaaaggttgcggaacctgcgcagcagtg
tgtccaaaagatgccattgaaatgcgacctgaaacggatttccagggggaggagtga

DBGET integrated database retrieval system