KEGG   Kosmotoga olearia: Kole_0519Help
Entry
Kole_0519         CDS       T00914                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kol  Kosmotoga olearia
Pathway
kol00010  Glycolysis / Gluconeogenesis
kol00260  Glycine, serine and threonine metabolism
kol00680  Methane metabolism
kol01100  Metabolic pathways
kol01110  Biosynthesis of secondary metabolites
kol01120  Microbial metabolism in diverse environments
kol01130  Biosynthesis of antibiotics
kol01200  Carbon metabolism
kol01230  Biosynthesis of amino acids
Module
kol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kol_M00002  Glycolysis, core module involving three-carbon compounds
kol_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_0519
  Energy metabolism
   00680 Methane metabolism
    Kole_0519
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kole_0519
Enzymes [BR:kol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kole_0519
Membrane trafficking [BR:kol04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Kole_0519
Exosome [BR:kol04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kole_0519
  Exosomal proteins of melanoma cells
   Kole_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACR79241
UniProt: C5CEJ5
Position
568414..569046
Genome map
AA seq 210 aa AA seqDB search
MDLLLIRHGHSVGDDERRIKGSWDVELTPKGLKQAKLLKERLEKENYKCDLLFSSPLKRA
AQTAEAVSQAVGKPIIYDSRLREQDSGKFAGMTREEASKFSPPPDEKGYRNYVPIPGGES
LLDHIRRVSEFYLELIDKHMDKRVCIVTHGGTINVLLRIIYNLPVNQPYVDKHIYLFAMN
DTAMSRLIIRGPQDVITYYLNNFSHLTAIK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggatttgctccttatcaggcatggacattctgttggagacgatgaaagacgaattaaa
ggaagctgggatgtcgaactcactccaaagggtcttaaacaggcaaagctgctcaaagaa
agactggaaaaagagaattacaaatgtgaccttcttttttcaagcccattgaaacgtgca
gctcaaactgctgaagcagtttctcaggctgtgggaaagcctataatctatgattcaagg
ttacgtgaacaggattcaggaaaattcgcgggaatgaccagggaagaggcttcaaaattt
agtccaccgccagatgaaaagggttacagaaactatgttccgatacctggtggagaatca
ctgttagaccatatccgcagggtgagcgaattctatctcgaacttatcgataagcatatg
gataagcgagtctgtatagtgacccacggtggaaccataaatgtattgttgcggatcatt
tataacctgcctgtgaatcaaccgtatgtggataaacacatctatttgtttgctatgaac
gatacagctatgtccagattgataatcagaggtccacaggatgtcattacctattacctt
aataatttcagccacctgactgcgataaagtaa

DBGET integrated database retrieval system