KEGG   Kosmotoga olearia: Kole_0519Help
Entry
Kole_0519         CDS       T00914                                 

Definition
(RefSeq) Phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kol  Kosmotoga olearia
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kole_0519
   01230 Biosynthesis of amino acids
    Kole_0519
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_0519
  Energy metabolism
   00680 Methane metabolism
    Kole_0519
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kole_0519
Enzymes [BR:kol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kole_0519
Exosome [BR:kol04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kole_0519
  Exosomal proteins of melanoma cells
   Kole_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
568414..569046
Genome map
AA seq 210 aa AA seqDB search
MDLLLIRHGHSVGDDERRIKGSWDVELTPKGLKQAKLLKERLEKENYKCDLLFSSPLKRA
AQTAEAVSQAVGKPIIYDSRLREQDSGKFAGMTREEASKFSPPPDEKGYRNYVPIPGGES
LLDHIRRVSEFYLELIDKHMDKRVCIVTHGGTINVLLRIIYNLPVNQPYVDKHIYLFAMN
DTAMSRLIIRGPQDVITYYLNNFSHLTAIK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggatttgctccttatcaggcatggacattctgttggagacgatgaaagacgaattaaa
ggaagctgggatgtcgaactcactccaaagggtcttaaacaggcaaagctgctcaaagaa
agactggaaaaagagaattacaaatgtgaccttcttttttcaagcccattgaaacgtgca
gctcaaactgctgaagcagtttctcaggctgtgggaaagcctataatctatgattcaagg
ttacgtgaacaggattcaggaaaattcgcgggaatgaccagggaagaggcttcaaaattt
agtccaccgccagatgaaaagggttacagaaactatgttccgatacctggtggagaatca
ctgttagaccatatccgcagggtgagcgaattctatctcgaacttatcgataagcatatg
gataagcgagtctgtatagtgacccacggtggaaccataaatgtattgttgcggatcatt
tataacctgcctgtgaatcaaccgtatgtggataaacacatctatttgtttgctatgaac
gatacagctatgtccagattgataatcagaggtccacaggatgtcattacctattacctt
aataatttcagccacctgactgcgataaagtaa

DBGET integrated database retrieval system