KEGG   Kosmotoga olearia: Kole_0534Help
Entry
Kole_0534         CDS       T00914                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kol  Kosmotoga olearia
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Kole_0534
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Kole_0534
Exosome [BR:kol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kole_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
585320..586780
Genome map
AA seq 486 aa AA seqDB search
MGYILAIDQGTSSSRAIIFDEDLYQVASAQKPFKQIYPKPGWVEHDPNEIVLSVMSCVEK
AIQDAKISFKDIEAIGITNQRETIVAWDAETGKALYNAIVWQCRRTADRAKELERQYRNF
IHSKTGLLPDPYFSATKMEWMLRNVPEVRKAAKKGTLRFGTIDSWLIWNLTPDRQHVTDH
SNASRTMLYNLNELKWDEELLEFFGIEKEFLPKVVDSSKLLIRSVYGPVISGIAGDQQAS
LFGQTAFNVGDVKCTYGTGSFILMNTGDKPRFSREGLLTTVGWKINDEIVYAIEGSIFTT
GALINWLKDGLQIISTPEETELLATSVEDNGGVYFSGALAGLGAPYWDSKARGLIIGLTR
GATRAHIVRAVLEYIAFRTKEILEIMERDTGIKVNRLLVDGGVTRNNFLMELQSKVLGVT
VDRPIVKETTALGAAMLAGLAVGLWDKETLAGIRKSEVVFTPTRKELEDEYKKWKEAIKR
SMNWAE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggggtacatcctggcaattgatcaggggaccagtagttcaagggctattatctttgat
gaggatctctatcaagttgctagcgcacaaaagcctttcaaacaaatttatccgaaacct
ggctgggtggagcatgatccaaacgagatagttctcagtgttatgtcttgtgtggaaaaa
gcaattcaagacgctaagatctcttttaaggacattgaggcgataggcataaccaaccag
agagaaacgatcgttgcctgggatgccgaaacgggcaaagctctctacaatgccattgtc
tggcaatgtagaaggacagcggatagggctaaagaactggaaagacaatatcggaatttt
atacattcaaaaactggtttgcttcctgacccttatttttcggcaacaaagatggaatgg
atgctaagaaatgttccagaagttagaaaagccgcgaaaaaaggaactttaagatttggt
accatagattcctggttgatttggaatctaacacctgacagacaacatgtaaccgatcac
tcaaacgcttccagaaccatgctttataacttgaacgagttgaaatgggacgaagaattg
ctcgagtttttcggtatcgaaaaagaatttttgccaaaggttgttgattcttcaaaactg
ctgatacgttctgtatatggcccggtaatatccggcattgccggagatcaacaagcatct
cttttcgggcaaaccgcttttaacgtaggtgacgtaaaatgtacctacggaaccggttct
ttcatcctgatgaacactggagataaaccaagattctcgagagaagggcttttaaccacc
gtaggttggaagatcaacgatgaaattgtctatgcaatcgagggctcaatatttacaaca
ggtgcccttataaactggctgaaagatggtttgcagataatctccactcccgaagaaacg
gagttattggcaaccagtgttgaagataatggcggtgtctatttttctggtgcccttgcc
ggtctcggtgcaccatactgggattctaaagcccgcggcttgatcataggtttaaccaga
ggagcaacccgtgcacatatagtcagagctgtgttagaatacattgcttttagaacaaaa
gaaatactggaaataatggaaagggatacaggaataaaggtcaatcgactccttgttgat
ggtggcgttacgaggaacaactttttgatggaacttcagtctaaagtattaggtgtaact
gtcgatagaccaatagtcaaggagaccacagcacttggagcagccatgcttgccgggctc
gcagttggtttatgggataaagaaaccctcgcgggaatacggaaaagcgaagtcgttttt
accccaacgagaaaagaattggaggatgaatacaaaaagtggaaagaagcgataaaacgt
tctatgaactgggcggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system