KEGG   Kosmotoga olearia: Kole_0695Help
Entry
Kole_0695         CDS       T00914                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kol  Kosmotoga olearia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kole_0695
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kole_0695
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kole_0695
Enzymes [BR:kol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kole_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
749857..751131
Genome map
AA seq 424 aa AA seqDB search
MRSRIRVNLPVEEMPKKWYNVKADLPFKLDPPLHPATQQPMKPEELSRIFPPSIVEQEAT
EERFVEIPEEVLEEYVVFRPTPLIRATFLEEYLQTPARIYYKYEGTSPTGSHKTNTALAQ
AFYNAKDGIKRLVTETGAGQWGSALSYAGRKFGLEVKVFMVRISYEQKPMRKYMMNLFDG
TVTPSPSELTSSGKKFLSQDPSHPGSLGIAISEAIEEVMADPNTRYSLGSVLDHVLLHQT
VIGLEIEKQLELIGEKPTIVMGCHGGGSNFGGTVLPFIPRKLAGENIRFVACEPESCPTL
TKGEFRYDSGDSAGFTPLIKMYTLGKEFVPPKIHAGGLRYHGSAPIIARLVHEGIIEAES
FDQEKTFEAARLFAKLEGIIPAPEAAHAIAGAIKEAIAAKEEKREEVIVFTLSGHGLMDL
TAYV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgagaatcagagtaaatcttccggttgaggagatgccgaaaaaatggtacaac
gtgaaagctgatctacctttcaagctcgatccaccactgcatccagcgactcagcagccg
atgaaaccggaggaactttcgaggatattccctccctccattgttgaacaggaagcaact
gaagaaagatttgtagaaattccagaagaagtcctggaagagtatgtggtcttcaggccc
acacctctaataagagctaccttccttgaggaatatctccagacgcctgctcgcatttat
tacaaatatgaaggcacctcaccaacgggaagccacaaaaccaacaccgccctcgctcaa
gctttttacaacgcgaaagatggaatcaaacggctcgttaccgaaacgggagcaggtcaa
tggggaagcgcgttgtcatatgctggaagaaagtttgggttggaagtcaaggttttcatg
gtgcgtatcagttacgaacaaaaaccgatgagaaaatacatgatgaacctatttgatgga
actgtcacaccgagtccaagtgaactcacttcaagcgggaagaaatttctgtcgcaagat
ccctcacatcccgggtctcttggtattgctataagcgaagcgatcgaagaggttatggct
gatcccaatacaaggtactcgctcggaagcgttctagatcacgttcttttacaccaaacg
gttattggattagaaatagaaaaacagctggaactgattggcgaaaagccaacgattgtt
atgggctgccacggtggcggctcgaatttcggaggaacggttctcccattcattccaaga
aagcttgctggagagaatatccggtttgtggcttgtgaaccggaatcctgtccgacattg
acaaagggtgaattcaggtacgattccggagattcagcaggttttacaccgctgatcaag
atgtacactctcggaaaagaattcgtaccgccaaaaatccatgctggaggacttagatac
cacgggtcagccccaatcatagcgcgtttagttcacgaagggataattgaagcagaaagc
tttgatcaagaaaaaactttcgaagctgcaaggctctttgcaaaattggaaggaattatc
ccagcaccagaagccgcccatgcaatagcaggagccataaaagaagcaatagctgctaaa
gaggaaaaacgtgaagaagtaatagtttttactctcagtggacacgggttaatggatctt
acagcatacgtttga

DBGET integrated database retrieval system