KEGG   Kosmotoga olearia: Kole_0695Help
Entry
Kole_0695         CDS       T00914                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kol  Kosmotoga olearia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kole_0695
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kole_0695
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kole_0695
Enzymes [BR:kol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kole_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
749857..751131
Genome map
AA seq 424 aa AA seqDB search
MRSRIRVNLPVEEMPKKWYNVKADLPFKLDPPLHPATQQPMKPEELSRIFPPSIVEQEAT
EERFVEIPEEVLEEYVVFRPTPLIRATFLEEYLQTPARIYYKYEGTSPTGSHKTNTALAQ
AFYNAKDGIKRLVTETGAGQWGSALSYAGRKFGLEVKVFMVRISYEQKPMRKYMMNLFDG
TVTPSPSELTSSGKKFLSQDPSHPGSLGIAISEAIEEVMADPNTRYSLGSVLDHVLLHQT
VIGLEIEKQLELIGEKPTIVMGCHGGGSNFGGTVLPFIPRKLAGENIRFVACEPESCPTL
TKGEFRYDSGDSAGFTPLIKMYTLGKEFVPPKIHAGGLRYHGSAPIIARLVHEGIIEAES
FDQEKTFEAARLFAKLEGIIPAPEAAHAIAGAIKEAIAAKEEKREEVIVFTLSGHGLMDL
TAYV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgagaatcagagtaaatcttccggttgaggagatgccgaaaaaatggtacaac
gtgaaagctgatctacctttcaagctcgatccaccactgcatccagcgactcagcagccg
atgaaaccggaggaactttcgaggatattccctccctccattgttgaacaggaagcaact
gaagaaagatttgtagaaattccagaagaagtcctggaagagtatgtggtcttcaggccc
acacctctaataagagctaccttccttgaggaatatctccagacgcctgctcgcatttat
tacaaatatgaaggcacctcaccaacgggaagccacaaaaccaacaccgccctcgctcaa
gctttttacaacgcgaaagatggaatcaaacggctcgttaccgaaacgggagcaggtcaa
tggggaagcgcgttgtcatatgctggaagaaagtttgggttggaagtcaaggttttcatg
gtgcgtatcagttacgaacaaaaaccgatgagaaaatacatgatgaacctatttgatgga
actgtcacaccgagtccaagtgaactcacttcaagcgggaagaaatttctgtcgcaagat
ccctcacatcccgggtctcttggtattgctataagcgaagcgatcgaagaggttatggct
gatcccaatacaaggtactcgctcggaagcgttctagatcacgttcttttacaccaaacg
gttattggattagaaatagaaaaacagctggaactgattggcgaaaagccaacgattgtt
atgggctgccacggtggcggctcgaatttcggaggaacggttctcccattcattccaaga
aagcttgctggagagaatatccggtttgtggcttgtgaaccggaatcctgtccgacattg
acaaagggtgaattcaggtacgattccggagattcagcaggttttacaccgctgatcaag
atgtacactctcggaaaagaattcgtaccgccaaaaatccatgctggaggacttagatac
cacgggtcagccccaatcatagcgcgtttagttcacgaagggataattgaagcagaaagc
tttgatcaagaaaaaactttcgaagctgcaaggctctttgcaaaattggaaggaattatc
ccagcaccagaagccgcccatgcaatagcaggagccataaaagaagcaatagctgctaaa
gaggaaaaacgtgaagaagtaatagtttttactctcagtggacacgggttaatggatctt
acagcatacgtttga

DBGET integrated database retrieval system