KEGG   Kosmotoga olearia: Kole_0876Help
Entry
Kole_0876         CDS       T00914                                 

Definition
glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kol  Kosmotoga olearia
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kol00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:kol00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(921999..923585)
Genome map
AA seq 528 aa AA seqDB search
MFSESFKMLLLGTLTLSQFVSMMSIEQKVGQLFLFGFQGISYNDQIQLLIDKGVRGFVIF
GRNVKDKDQVKELVEQIKTHCDDIPPFVAVDQEGGMVARIRDIFVPPNAMLLGSVNDTEL
TYKVGYLTGKALRDLGINMDFAPVLDVNSNPFNPIIGVRSFWNEPTRVATNGVAFFKGLL
SAGVIPVGKHFPGHGDTDTDSHTSLPVINKPESNFIETDVSPFKIAVENKIPALMTAHIL
LPFWDNVPATISKKIISYLREKLGFDGVIISDDMLMKAVSEGKSVKEAVKQSLLAGVDMF
IIWKDLETQLEVADYILQEVKNGNIPEEVIDNAVKRITKLRLLAYASELNELDLQVEKIW
EEISDGIALCKGNFSLEKDKKYLIFFPYNPGVSIVQERAYTREYITSLLKKEGITFKLVK
YNLRSTPYRYIKTIKKASTYDGVIIFTMDTYRNKYSAELVNLLIHENKNNLLIAIQSPYD
YLFVKDKELVNAYITTYDWNEYLAIRLLDYLIDNTPLKGECILTKGGI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgaaagttttaagatgctcctgcttggaacattaacactctctcaatttgta
agtatgatgtccattgaacagaaagttggacagcttttcctctttggatttcagggaatc
tcttacaatgaccagatccagttgttgatagataagggagttagaggttttgtcattttt
ggacgaaacgttaaagataaagatcaggtaaaagaacttgttgaacagatcaaaacacac
tgtgatgatatcccgcctttcgttgccgttgaccaggaaggcggtatggtcgccagaatc
agggatatctttgtacctccaaatgctatgctgttgggctctgtaaacgacacggaatta
acctataaagtaggttatctaacgggaaaagcgttgagagatctgggaatcaatatggac
ttcgcaccggtacttgatgttaattcaaatccctttaacccaatcataggagtgcgatcg
ttctggaacgagccaacaagggtagctacgaatggagttgctttctttaaaggtcttctt
tctgccggggttattccagttggaaagcattttcctgggcatggagatacggatacagat
tcccatacttcacttccagttatcaataagcctgaaagcaactttatcgaaactgatgtg
tcccctttcaaaatcgctgtagaaaataagataccggcattgatgactgctcatatatta
ttgcctttttgggacaacgttccagccacaatatctaagaaaataatctcctatttgaga
gaaaagttaggttttgatggagtaatcatcagcgatgacatgcttatgaaagcagtctcg
gaaggtaaatccgtgaaagaagcggtgaaacaatcactgttagccggtgttgatatgttc
atcatctggaaagacttagaaactcagctggaagtagcggattacatcctccaggaagta
aaaaacggaaatatccctgaggaagttatagataatgcggttaaaagaatcacgaaactt
cgtctgttagcgtacgcttccgaacttaatgaactcgatctacaagtagaaaagatctgg
gaagaaatttctgatggaatagcactgtgcaagggtaatttttccctggaaaaggacaaa
aagtatctcatcttcttcccctataacccgggtgtatcgattgttcaagagcgtgcttat
accagggaatacataacgtctttactgaagaaagaaggaataactttcaaactggttaaa
tacaatctacgctcaaccccatacagatatataaaaaccataaaaaaagcaagtacttat
gatggggtaataatattcacgatggatacctacagaaacaagtattccgctgaactcgta
aatctgttgattcacgaaaacaagaataacctcttgattgcgattcaatctccttacgat
tatctttttgtcaaagacaaagagttggttaatgcgtatataacaacatatgattggaat
gaatatctcgctattagattgttagattatttgattgacaacaccccacttaaaggcgag
tgcattttaacaaagggagggatttag

DBGET integrated database retrieval system