KEGG   Kosmotoga olearia: Kole_0919Help
Entry
Kole_0919         CDS       T00914                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
kol  Kosmotoga olearia
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Kole_0919
Enzymes [BR:kol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Kole_0919
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Kole_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
972789..973760
Genome map
AA seq 323 aa AA seqDB search
MSEQTVKGELRVIPISVSKAIVPEEARRTTAGEYLVNALKEKGIEVQDKDVFVLTSKLVS
LFDGRTINLSTVTPSRKAKILGKLFHKDPREVELIMREGKVLAVIPFKKIAKNPAIWKRM
LQFSANPEGTRQALDISTYVFVVNNHAAYLDDAGIDFSNSPPDYVTLLPKDPCASAKRIR
KEIMDLTGKEVAVIITDTVSVLGRMGSQDIAIGYSGIDPITRKSGKEDLFGEPHLGGNDL
VIDSMAGIAGLVMGQMNESTPATLIRGYDYEPEREDEEPKGMELIAYPKSMAFRSSVLTI
LTTVWFRIVNFFTFQKWPKDEEN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaacaaactgtaaaaggagaactcagggttataccgataagtgtttcgaaggct
atcgtacccgaggaggctcgaagaactacagctggagaatatcttgttaatgcccttaaa
gaaaaaggaatagaggttcaggataaggatgtttttgtactcacttcaaaattagtctcg
ctcttcgatggtagaacaatcaatttgagtacagtgactccctcgagaaaagcgaagatt
cttggcaaacttttccataaagatccccgtgaggttgaactgataatgcgtgaaggaaag
gttctggctgttatacctttcaaaaaaattgcgaaaaaccccgctatatggaagcgaatg
ctccagttttcggctaaccccgaaggtacacgccaagcgctcgatatatcaacatatgtt
tttgttgtcaataaccacgcagcttatctcgatgacgctggtatagatttttccaattct
ccaccagattatgtaacgctactacctaaggacccttgtgccagcgctaaaagaattcga
aaagaaatcatggatttaaccggtaaagaagttgctgtgattatcaccgataccgtttcc
gtgttaggaagaatgggatcgcaagacattgccataggttattctggtattgacccaatt
acaagaaaaagcggtaaggaagatctttttggagagcctcatcttggaggaaacgacctt
gttattgattctatggctggaattgcaggacttgtcatgggacagatgaacgaaagtact
cctgcgacacttatcagaggatatgattacgagccagaaagagaagatgaagaacctaaa
ggtatggagttaatagcttatccgaagagtatggcttttagatcaagtgttctaacgata
ttaacaactgtctggtttcgcatagtcaatttttttacctttcaaaaatggccaaaagat
gaagaaaattaa

DBGET integrated database retrieval system