KEGG   Kosmotoga olearia: Kole_1001Help
Entry
Kole_1001         CDS       T00914                                 

Definition
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kol  Kosmotoga olearia
Brite
Enzymes [BR:kol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Kole_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1058071..1058805)
Genome map
AA seq 244 aa AA seqDB search
MKSRDLADELLQRNIIRDSRIYQAMCEIDRSEFVLPKYKFLAHIDEVLPSAEKNGFIIST
STQPSLVVQMIQNLNLTGNEKVLDIGTGTGYATLILAKILKDGEVISIEYNRELHEIALR
NFERYGVENITCISGDGFEGYSLKAPYDAIISMVACETLPVQWIEQLKSSGGRIVAPIVF
NSFYTPVYKFTRKGEQIHAYKLIDAVFMSMKGQHEYRTFLPQIFDYELIFDGKNLKPIDE
NTLD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccgtgacctcgccgatgaactgctccagaggaacatcataagagattcaaga
atttatcaggcgatgtgcgaaattgacagaagcgagtttgtcctgccgaaatataaattc
ctcgcgcacatcgatgaagtccttccttccgcagaaaagaacgggttcatcatcagcacc
tcaacccaaccatcccttgttgtccaaatgattcaaaatctaaatctcacaggaaatgag
aaagtgcttgacatagggacaggaacaggatatgccactctaatactcgccaaaattctc
aaagatggcgaagtcattagcatcgagtacaatcgtgaactccatgaaatagcactaagg
aatttcgaacgttatggggttgaaaatattacctgcatcagtggagacggatttgaggga
tatagtttgaaggctccttacgatgccataatctctatggttgcttgcgaaacccttccc
gttcaatggatagaacaactcaaaagttcaggtggaaggatcgttgccccgattgtcttc
aacagcttttacacaccagtttataagttcacaagaaagggagagcaaatacacgcttat
aagttaatagacgctgtttttatgtcaatgaaagggcaacacgaatatagaacgttctta
cctcagatcttcgactacgaacttattttcgatggaaaaaatttaaaacccattgatgaa
aacactctggattaa

DBGET integrated database retrieval system