KEGG   Kosmotoga olearia: Kole_1001Help
Entry
Kole_1001         CDS       T00914                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kol  Kosmotoga olearia
Brite
Enzymes [BR:kol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Kole_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_3 RrnaAD Methyltransf_18 MTS Methyltransf_4 Methyltransf_15 Methyltransf_23 Methyltransf_32 CMAS Methyltr_RsmB-F Methyltransf_11 GidB Methyltransf_12 Met_10 DOT1 PrmA Ubie_methyltran GCD14 DUF2827 DUF938 TrmK TehB Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: ACR79709
UniProt: C5CHF4
Position
complement(1058071..1058805)
Genome map
AA seq 244 aa AA seqDB search
MKSRDLADELLQRNIIRDSRIYQAMCEIDRSEFVLPKYKFLAHIDEVLPSAEKNGFIIST
STQPSLVVQMIQNLNLTGNEKVLDIGTGTGYATLILAKILKDGEVISIEYNRELHEIALR
NFERYGVENITCISGDGFEGYSLKAPYDAIISMVACETLPVQWIEQLKSSGGRIVAPIVF
NSFYTPVYKFTRKGEQIHAYKLIDAVFMSMKGQHEYRTFLPQIFDYELIFDGKNLKPIDE
NTLD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccgtgacctcgccgatgaactgctccagaggaacatcataagagattcaaga
atttatcaggcgatgtgcgaaattgacagaagcgagtttgtcctgccgaaatataaattc
ctcgcgcacatcgatgaagtccttccttccgcagaaaagaacgggttcatcatcagcacc
tcaacccaaccatcccttgttgtccaaatgattcaaaatctaaatctcacaggaaatgag
aaagtgcttgacatagggacaggaacaggatatgccactctaatactcgccaaaattctc
aaagatggcgaagtcattagcatcgagtacaatcgtgaactccatgaaatagcactaagg
aatttcgaacgttatggggttgaaaatattacctgcatcagtggagacggatttgaggga
tatagtttgaaggctccttacgatgccataatctctatggttgcttgcgaaacccttccc
gttcaatggatagaacaactcaaaagttcaggtggaaggatcgttgccccgattgtcttc
aacagcttttacacaccagtttataagttcacaagaaagggagagcaaatacacgcttat
aagttaatagacgctgtttttatgtcaatgaaagggcaacacgaatatagaacgttctta
cctcagatcttcgactacgaacttattttcgatggaaaaaatttaaaacccattgatgaa
aacactctggattaa

DBGET integrated database retrieval system