KEGG   Kosmotoga olearia: Kole_1014Help
Entry
Kole_1014         CDS       T00914                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kol  Kosmotoga olearia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kole_1014
   01230 Biosynthesis of amino acids
    Kole_1014
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1014
   00030 Pentose phosphate pathway
    Kole_1014
   00051 Fructose and mannose metabolism
    Kole_1014
   00052 Galactose metabolism
    Kole_1014
  Energy metabolism
   00680 Methane metabolism
    Kole_1014
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Kole_1014
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kole_1014
Protein phosphatases and associated proteins [BR:kol01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Kole_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1074120..1075349
Genome map
AA seq 409 aa AA seqDB search
MKKRNLIYGQSGGVTSVINASAYGAIIAAINNPMVENVYAALNGIKGILEERIIDLKAES
KDEIEKIAFTPGAIFGSCRTKLKTEEDFERLFKVFDAYDIGYFLYNGGNDSMETAYQIAL
KAQEYGYPLKVIGIPKTVDNDLMYTDHCPGYGSAAKFTAISILEATRDLESMHTDSTQVF
ILESMGRYAGWLAASGILASINGERGPQIFLLPEVPFNEEKFLSKVEEVIRRDGYCSIVA
AEALKDSEGNYISTEDYTDAFGNIQLGKIGIYLQKLIRQNLGRKVHTALPDYLQRSSRHI
ASLTDWEEAIGVGAAAVKFAVDQGLSGVMVSIVRDLDSPYLKHYEPVSLEGIGGKVKYLP
EEYISPDGFGVTEKFVEYVRPLIQGEAPNHYLRGIPVYANLKKVPVKRK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagaaatctaatatatggccaatctggcggagtgacatctgtgataaacgct
tcagcatacggtgctataattgcagccatcaacaaccctatggttgagaatgtttacgct
gctctgaacgggataaagggaatactggaagaaagaataatcgatttgaaagccgaatca
aaggatgagattgaaaagattgcttttactcctggagcaatctttggctcttgcaggaca
aagctcaaaactgaagaagatttcgagcggttgttcaaagtctttgacgcatacgatata
ggttattttctatacaatggcgggaacgactctatggaaaccgcttatcaaatagcgtta
aaagcacaggaatacggctatccgctgaaagtaataggaatccccaagactgttgataat
gaccttatgtatactgaccattgtcccggttatggctccgcagcaaaatttacagccata
tcaattcttgaagctacaagagatctggagtcaatgcataccgactcgactcaggttttc
atactagaatccatgggacgctatgccggttggcttgctgcttcagggattcttgcaagt
ataaatggagaacgcggccctcaaatctttcttctaccggaggtacccttcaatgaagag
aaatttctgtcgaaagttgaggaagtcataagaagagacggatattgcagcattgttgct
gctgaagctttaaaagactctgaaggaaattacatttcgacagaagattataccgacgca
tttggcaatatccagcttggaaagataggtatttacctgcaaaagttgatacgacaaaat
ctcggcagaaaggttcatacagctcttccggattatctccagcggtcttctagacacata
gccagcttgacagattgggaggaagccatcggagttggagctgctgcggttaaatttgcg
gttgatcaaggactaagtggtgttatggtgtcgatagtaagagatttagatagtccatac
ttgaagcactatgagcctgtcagtttagaagggataggtggaaaggttaagtatctgcca
gaagagtatatctccccggatggttttggtgtcaccgaaaagttcgtcgaatacgtaaga
cctttgatacagggcgaagctcccaaccattaccttcgagggataccggtatatgcaaat
ctgaaaaaagttccagtaaaaagaaaataa

DBGET integrated database retrieval system