KEGG   Kosmotoga olearia: Kole_1021Help
Entry
Kole_1021         CDS       T00914                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kol  Kosmotoga olearia
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kol01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kol00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1082538..1083929)
Genome map
AA seq 463 aa AA seqDB search
MNTKIDKMVLELRDKIVESVSELIKIPSVEGTPKPDAPFGEGVKKALDYALKLSESLGFN
VKNVDNYAGHAEFGNSGKLFGVLGHLDVVPEGDSWSVDPYSGVIKYGYIWGRGAIDDKGP
TIAALYALKAVKDSGIPVKNRIRVIFGTDEESGWKGIDYYLKKEEIPEMSVTPDASFPII
HAEKGIVNYHFLGETGEWKGNLRIEEIDGGNASNMVPASAYVVLNGELDEAEKLLKEFKP
KNDTKINWKKEGTKLRINFEGVSAHGAEPQNGVNAIAPMLDLLSKLNLNNESFERFIKLL
NEKIGYEIDGNSLGISGMDGITGPLTVNLGTLKANGDALEAVINIRYPVFFNEERIFSQV
KEAMKGLTVERKHHHDPLYMSPDSDLVRLLKEVYEEVTGEEAKLLTTGGGTYARAVPNAV
AFGALFPGREFTGHKPDERVLIDDLIMLARIYAQLFYRVLTEW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacaaaaattgacaaaatggttcttgaattgcgcgacaaaatagttgaatccgtt
tcagaacttattaaaataccctccgttgaaggaacgccaaaacccgatgctccatttggt
gaaggtgttaaaaaagcattggattatgcccttaaattgagtgaatctctggggttcaac
gttaaaaacgtagataattacgcagggcacgccgaattcggtaactcaggaaaactgttt
ggagttttaggtcaccttgatgttgttccggaaggtgacagttggagcgtcgatccttac
agtggggttataaaatatggttatatatggggtagaggagcaattgatgataaaggacca
acgatagccgctctttacgcacttaaggctgtaaaagattctggaattccagtcaaaaac
agaattagagttatattcggtacagatgaagagtcaggctggaagggtattgattattac
ctcaaaaaagaagaaattcctgaaatgtccgttacccccgatgcttcgttccctatcatt
cacgcggagaagggaatagtaaactatcattttcttggggaaacaggagaatggaaggga
aacttgcgaatagaagaaattgatggtggcaacgcttcgaatatggttccagcatccgct
tatgttgtgctcaacggagaactcgatgaggcagaaaagcttctcaaagaattcaaacca
aagaatgatactaagataaactggaaaaaggaaggaaccaaactgagaattaacttcgaa
ggcgtttcagcacacggtgcagaacctcaaaatggtgtcaacgcgatagctccaatgctc
gaccttctttcaaagctaaatttaaacaacgagtcatttgaaaggtttattaaacttctg
aacgaaaaaatcggctatgaaatcgatggtaattccctcgggatttccgggatggatgga
atcacaggaccccttacggtaaatctaggaacactcaaggcaaacggagacgcgttagaa
gcggttataaacataagatatccagtcttcttcaacgaagaacggattttctcgcaggta
aaagaagcaatgaagggcttaacagtggaaaggaaacatcatcatgatccactctatatg
tcaccagacagcgatcttgtgagacttcttaaagaagtctatgaagaggttacaggggaa
gaagcaaagcttctcacaaccggtggcgggacctacgccagagctgttcccaatgctgta
gcctttggagcacttttcccgggtagggagttcaccggtcacaaacccgatgagagagtc
ctcatcgatgatctgataatgctggcaagaatatatgctcaactgttctatcgtgttcta
acagagtggtaa

DBGET integrated database retrieval system