KEGG   Kosmotoga olearia: Kole_1359Help
Entry
Kole_1359         CDS       T00914                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kol  Kosmotoga olearia
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kole_1359
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Kole_1359
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Kole_1359
Enzymes [BR:kol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Kole_1359
Exosome [BR:kol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kole_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1442031..1443359
Genome map
AA seq 442 aa AA seqDB search
MRRFLLVFVLLLIVSLLVASGVKNVIYMIGDGMGINHVLLTSYLEGRELYMLQAPYTGFV
LTFSANSNVPDSASAGTALASGYKTNNGMIGMLPDGTVITNIAEIAAQYGIKTGIVATCR
ITHATPAAFYGHVSSRRDENTLAEQLVDSSLTVAFGGGWRHFVPTGGKRKDGKDLIAIAK
ANGFDYITTKTELLNYDGDRVLGLFSYSHLKAASERTGEEPMLPEMVEKALEILSKDDSP
FFLMVEGSQIDWEAHGNDVYGLWKEIVEFDNAVKVALDFAKEHPNTLIVITADHETGGLG
LSTGGYTMNLEKIRKDYTKTADWIVSNFGDSDEELKEAVKTYFNVELTDEDLAYYHEEKA
KSFNGAGNAIGRILSNKAQIGWTTHDHTGGAVPIFAFGPGAELFSGVHDNTEIPNLIAYL
LGIGKVSDVEYGIEDVPLVGGH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggtttttgcttgtctttgttcttttgcttatagtttcattgctcgttgcttct
ggtgttaagaacgttatctacatgattggtgacggtatgggaattaaccatgtccttttg
acaagttatcttgagggtagggaactttacatgcttcaggctccctacacagggtttgtc
ctgactttttcagcaaacagcaatgttccagattcagcgtctgctggaacagcgctagca
tctggctacaaaaccaacaacggaatgatcggcatgcttccagacggaacagtaatcacc
aacatcgctgagatcgcggctcagtatggtatcaagacaggaattgttgccacctgccgt
ataactcacgcaactccagctgctttctacggtcacgtaagttcaagaagagatgaaaat
acgctagctgagcagctcgtagacagttctttgaccgttgcttttggtggcggttggaga
cattttgtcccaacgggtggcaaaaggaaagacgggaaagatcttatagcaatagctaaa
gccaatggtttcgactacatcacgacaaaaacagagttgttgaattacgatggtgacaga
gtcctcggactcttcagctacagtcatctcaaagccgcttccgaaagaactggagaagaa
ccaatgcttccggaaatggttgagaaagctctcgagatactttcaaaagacgattctcca
ttcttcctgatggtcgaaggttctcagattgactgggaagcccacggaaacgatgtttac
ggtctatggaaagaaatcgtcgaattcgacaatgctgtgaaagtcgctcttgattttgca
aaggaacacccgaatacactcatcgttattactgcagaccatgaaacaggcggtctcgga
ctctccacaggcggatacacaatgaatctcgaaaagataaggaaggattacacaaaaacc
gctgattggatagtttctaatttcggtgattccgatgaggaactcaaggaagctgtcaag
acatacttcaatgttgagctcaccgatgaagaccttgcatattaccatgaagaaaaagcc
aaatctttcaacggtgcaggaaatgctatcgggagaatcctcagcaacaaagcccagata
ggctggacaacacatgaccacacaggaggagctgtcccgatatttgccttcggtccaggt
gctgaactctttagtggcgttcatgacaacaccgagattccaaatttgattgcttatctc
cttggaatcggtaaggtcagtgatgttgagtatggtattgaagatgtcccgttggttggt
ggacattga

DBGET integrated database retrieval system