KEGG   Kosmotoga olearia: Kole_1524Help
Entry
Kole_1524         CDS       T00914                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kol  Kosmotoga olearia
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Kole_1524
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1524
  Lipid metabolism
   00071 Fatty acid degradation
    Kole_1524
  Amino acid metabolism
   00350 Tyrosine metabolism
    Kole_1524
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Kole_1524
   00626 Naphthalene degradation
    Kole_1524
Enzymes [BR:kol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Kole_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1635746..1636861)
Genome map
AA seq 371 aa AA seqDB search
MWHYYLPTHVFFGETVVEKHGKVVQECGAKALIVTGRRSARLSGALHDIIKVLTELKIPY
IHFDRVEENPSFETVRKGTELLRKENCDFVIAIGGGSPLDAGKAMAIMGTDPDLKVEDLY
DRESYLFSLPVVAIPTTSGTGSEVTQYSVLTDDEGNKKGFATPHAFPMYSFLDPRYTITM
TEETTIATALDALSHSIEGELLNNAVNPIVKNHSRVTNELIKNNLKNATITPEDIPVRSL
LQYAAMLAGIVIAHTGTTVVHAAGYPLSSKRGIKHGIANAVFLVEVLRKVEESDPDRVKN
AIDPFESLNELEAFLNSFGVNEYKIELSDDELESWAEKAARAPHNARTPGEFDVEFYRNL
YKKVRKCQNTE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtggcattattatttaccaacacatgtttttttcggtgaaacagttgttgagaaacat
ggaaaagtggtgcaggaatgcggagcaaaagctctcatagttaccggaaggcgttctgca
aggttatcaggagcgttgcacgacattataaaggttttgactgaattgaagatcccttac
atacattttgatagggtggaagaaaacccgtcctttgaaacggtgagaaagggcaccgaa
cttctgagaaaagaaaattgtgattttgtcatcgccattggtggcggaagcccattagat
gccgggaaagctatggccataatgggtaccgatcctgatcttaaagtggaagatctttac
gatcgcgagagttatcttttctcactgcctgttgtcgcaatccctacaacctctggtaca
ggaagtgaagtcacccagtattctgttctaacggacgacgaaggcaataagaaaggcttt
gccacacctcatgccttcccgatgtattccttcctcgacccccgctacacgataacaatg
accgaagaaactaccatagctaccgctctagatgccctgtcccattctattgaaggcgaa
ctgttgaacaacgccgttaaccctatcgttaaaaaccattccagggtcacaaatgaactc
atcaaaaacaatctgaaaaatgcaacaatcaccccggaagatatccctgtaaggtcttta
ttgcaatatgccgcgatgcttgcaggaatagtaatagctcacacagggacaacagtggtt
cacgccgcaggataccctttatccagtaaaagagggataaaacacggcatagcgaatgcc
gtttttctggtagaagtgcttcgaaaagtcgaagaatcagatccggatagagtcaaaaat
gccattgacccctttgagtcgctgaacgaactcgaagctttcttgaactctttcggggta
aacgaatataagatagaactctcagacgatgaactggaaagctgggcggaaaaagctgcc
agagctccacacaatgcaagaaccccgggtgagttcgatgtcgagttttatagaaacctc
tataaaaaggtgagaaagtgccagaatacagagtaa

DBGET integrated database retrieval system