KEGG   Kosmotoga olearia: Kole_1618Help
Entry
Kole_1618         CDS       T00914                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
kol  Kosmotoga olearia
Brite
Enzymes [BR:kol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Kole_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1737109..1737861
Genome map
AA seq 250 aa AA seqDB search
MFNFSRTPKVMKGAESIHLEGNDNAVLLIHGFTGSPFELKELAHCLNESGYSVDVPRLPG
HGTVIEDMLTTRYQDWLRKVVDAYIDLKSKYKKVFVGGLSMGGTLTLALAEIFGDIDGIF
PLAAPIKLNRMDLKLTWLMKYFVKTRPKDPKGNVETVSYDADPIPQAWEMNKLMAMVRKN
LRRVTAPCLVVYSKKDGTVPYSNAELVYHGISSEKRKLVSLEESGHIITMDVEKEKVSSS
VMEFIRKIEK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttttcgagaactccgaaagtaatgaaaggtgcggaaagtatccatctggaa
ggcaatgataacgctgttctcttgattcatggttttacaggaagcccttttgagctcaaa
gaacttgctcattgtttgaacgaaagcggttactccgtggatgtcccaaggctgcccggt
catggtacggttattgaagatatgctaacaacaaggtatcaggattggctgagaaaggta
gtcgatgcgtacattgatttgaaatcgaagtacaaaaaagtttttgtgggcgggctctcc
atgggtggaacgcttacattggcgttagctgagatatttggtgatatcgatgggatattc
cctctggctgcccctataaaactgaacagaatggacttaaaactaacgtggttaatgaag
tattttgtcaaaactcggccaaaagacccaaagggcaacgttgaaactgtttcgtatgat
gccgatcctatacctcaggcgtgggaaatgaacaaacttatggcaatggttagaaagaat
ttgagaagggtgacagccccctgtctcgtggtttattctaaaaaagatggaaccgtaccg
tatagcaatgcagagcttgtataccacggtatttcatcggagaagaggaagcttgtgtcc
cttgaagaaagtggtcatataattaccatggatgtagaaaaagaaaaggtttcgtcgtct
gtgatggaattcataagaaaaatagaaaaataa

DBGET integrated database retrieval system