KEGG   Kosmotoga olearia: Kole_1643Help
Entry
Kole_1643         CDS       T00914                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kol  Kosmotoga olearia
Pathway
kol00051  Fructose and mannose metabolism
kol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Kole_1643
Enzymes [BR:kol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Kole_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACR80333
UniProt: C5CFC4
Position
1763396..1764034
Genome map
AA seq 212 aa AA seqDB search
MYEEYKKEIVEYGRKILNSNHVVGTSGNISVRIGNTSLFAITPSGMPYEELTVDDIPIID
VKGERIEGTKKPSIEVRMHGLIYEHYPDVRAIVHTHSVYTTVLSLIRKPLPIINETMVMV
GDVPVAEFARTGSLELAENVTKALKGRRAVILANHGLLCVGKSLKESFALCEEIERDAQI
YVLALSTGMSVHIIPEEEAKKTREWLSKNYGQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaagaatacaaaaaagaaattgttgaatacggcagaaagatacttaactcaaac
catgttgtcggtacgtcaggaaatataagtgttaggataggtaatacaagtctttttgcg
attactcccagtggaatgccatacgaagaattaaccgttgatgacatacccataatcgat
gtcaaaggcgaacgcatcgaaggaacaaaaaaaccatcgatagaggttcgaatgcatgga
cttatatacgaacactatccggatgttagagcgatagtacatactcattctgtttatacc
acggttttgtctcttattcgcaaaccgctgccgataataaacgagaccatggtaatggta
ggggatgttccggtagcggagtttgcacgcaccggaagcctcgaacttgcagaaaatgtc
actaaagctcttaaaggtagaagagcagttattcttgcgaatcacggattgctatgtgtc
ggaaaaagtttgaaagaaagttttgcgctttgtgaagagatagaacgggatgcccaaatc
tatgtcctcgcattgtcaacgggtatgagcgttcatattatcccagaagaagaagcgaaa
aaaacccgtgagtggctttcaaaaaactatgggcaatga

DBGET integrated database retrieval system