KEGG   Kosmotoga olearia: Kole_1696Help
Entry
Kole_1696         CDS       T00914                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kol  Kosmotoga olearia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kole_1696
   01230 Biosynthesis of amino acids
    Kole_1696
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_1696
   00030 Pentose phosphate pathway
    Kole_1696
   00051 Fructose and mannose metabolism
    Kole_1696
   00052 Galactose metabolism
    Kole_1696
  Energy metabolism
   00680 Methane metabolism
    Kole_1696
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Kole_1696
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kole_1696
Protein phosphatases and associated proteins [BR:kol01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Kole_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1825074..1826096)
Genome map
AA seq 340 aa AA seqDB search
MKVGILTGGGDCPGLNAVIRGIVKSAPKDIEIIGIMHGWKGLITGEVTKLTDDDVEGIHI
IGGTILGTSRTNPFKSEENKNKMLENIEKLGLDALIAIGGDDTLSVAAKLSSLGYKVIGV
PKTIDNDVSNTDYTFGYHTAVNVGADAIDRLHSTAKSHGRVLFVELMGREAGWITLEAGL
AAGAHLILIPEYPMTLEEIVRYVNERMDKKSYMIIAVAEGFKPTDLENVIGDKNEVDAFG
HIRLGGIAHYLAEIIKEKTGYDTRSVVLGHLLRGGTPTAFDRILGTRYGVHAMKLVLEKD
FGRMVALRGNAIVSIPLEYGIATKKFVPFEYYKLAQIFFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcggaattcttacaggtggtggagactgtccggggctaaacgcggttattcgt
ggaatcgttaaatcagctcccaaagacatagaaattatcgggataatgcacggttggaaa
gggctgattactggcgaggtcacaaaacttactgacgatgacgtcgaagggattcacatc
ataggtggaacgatactcggtacctcaagaacaaacccttttaaaagcgaggaaaacaag
aataaaatgcttgaaaacatagagaaactcgggcttgatgccctcatcgctattggtgga
gacgatactctgtctgtcgcagcaaagttatcctctctgggttacaaggttataggtgtt
ccaaaaaccatagataacgacgtttccaacaccgattacacatttggctatcatacagcg
gtgaacgttggtgctgatgccatagacagacttcattcaacagcaaaatcccacgggaga
gttctcttcgttgagctcatgggcagagaagcaggctggataacattagaagcaggactt
gcagctggtgctcatttgatactaatccccgaatacccgatgactcttgaagagatcgtc
aggtacgtgaatgaaaggatggataaaaagagctacatgatcatagcggttgcggaagga
tttaaacccactgaccttgaaaatgtcatcggtgataagaatgaagtcgatgcctttggc
catatacgtcttggaggaatcgcccattaccttgctgaaataataaaggagaaaaccgga
tatgatacccgctctgttgttcttggacatctgttaaggggcggaacacccacggctttt
gacaggatacttggaacccgttacggtgttcatgcaatgaaactcgttctcgaaaaggat
tttggtagaatggtagctctgcgtggaaatgcaatcgtttcaattcctctggaatatggg
atagccaccaaaaaattcgttcccttcgaatactacaaactcgcgcagatattctttgga
tga

DBGET integrated database retrieval system