KEGG   Kosmotoga olearia: Kole_1735Help
Entry
Kole_1735         CDS       T00914                                 

Definition
RuvA domain protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kol  Kosmotoga olearia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kol03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1863087..1863674)
Genome map
AA seq 195 aa AA seqDB search
MIKGVEGEITEISGNEVTLKAGQFYLNILCSTNTIKELSLSAKVHLLTYLSFSADRAPEI
YGFKDRAEYNVFLMLLKANKIGPKMALKILSATSPEMLQKMIASKDISGLSRLPGLGKKT
AERLVSELYDLVKDYAVEFPKELSDVSEDAVGALTALGFDMTSAKLAVNEVLKEQTVENT
QELVRKALRKLNKTR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaggcgttgaaggagaaataacagagatatccggaaacgaggtcacactgaag
gcaggacagttctatctgaacattctgtgttcgaccaatacaataaaggaactttcactg
tcggcaaaggttcatcttttgacgtacctttctttctcagccgacagggcccctgaaata
tacggcttcaaagaccgtgcggaatataacgtctttttaatgctgttaaaagcgaataag
ataggcccaaaaatggctttgaaaattctctctgcaacttctccggaaatgcttcagaag
atgatagcgtcaaaagacatttccgggctttccagattgccaggattaggtaaaaaaacc
gccgaaaggctggttagtgaactttacgatctcgtaaaagactatgcggtagagttcccg
aaagaactgagtgacgtttctgaagacgcggtcggcgcgctgaccgctctgggattcgat
atgacaagcgccaaattggctgtaaacgaggtcctgaaagagcaaacggtagaaaatacc
caggaattggtaaggaaagctctgagaaaactaaataagacccggtaa

DBGET integrated database retrieval system