KEGG   Kosmotoga olearia: Kole_1735Help
Entry
Kole_1735         CDS       T00914                                 

Definition
RuvA domain protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kol  Kosmotoga olearia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kole_1735
Enzymes [BR:kol01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Kole_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1863087..1863674)
Genome map
AA seq 195 aa AA seqDB search
MIKGVEGEITEISGNEVTLKAGQFYLNILCSTNTIKELSLSAKVHLLTYLSFSADRAPEI
YGFKDRAEYNVFLMLLKANKIGPKMALKILSATSPEMLQKMIASKDISGLSRLPGLGKKT
AERLVSELYDLVKDYAVEFPKELSDVSEDAVGALTALGFDMTSAKLAVNEVLKEQTVENT
QELVRKALRKLNKTR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaggcgttgaaggagaaataacagagatatccggaaacgaggtcacactgaag
gcaggacagttctatctgaacattctgtgttcgaccaatacaataaaggaactttcactg
tcggcaaaggttcatcttttgacgtacctttctttctcagccgacagggcccctgaaata
tacggcttcaaagaccgtgcggaatataacgtctttttaatgctgttaaaagcgaataag
ataggcccaaaaatggctttgaaaattctctctgcaacttctccggaaatgcttcagaag
atgatagcgtcaaaagacatttccgggctttccagattgccaggattaggtaaaaaaacc
gccgaaaggctggttagtgaactttacgatctcgtaaaagactatgcggtagagttcccg
aaagaactgagtgacgtttctgaagacgcggtcggcgcgctgaccgctctgggattcgat
atgacaagcgccaaattggctgtaaacgaggtcctgaaagagcaaacggtagaaaatacc
caggaattggtaaggaaagctctgagaaaactaaataagacccggtaa

DBGET integrated database retrieval system