KEGG   Kosmotoga olearia: Kole_1771Help
Entry
Kole_1771         CDS       T00914                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kol  Kosmotoga olearia
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Kole_1771
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Kole_1771
Enzymes [BR:kol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Kole_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1903157..1904422
Genome map
AA seq 421 aa AA seqDB search
MSEIVVEGGRKLIGEVPISGSKNAALPILAAAVMIDEPVVLDNVPELKDVFTMLTILQRI
GKKVSFRDNRVVVEPGNVLMGDVPYELVRMMRASFNVLGPLTMVCGWAKVGKPGGCNIGQ
RPVDFHIEGLKALGFLIKEEHGDVIAKKPSSFKEELYYKLPFPSVGATEQLMTVAALMSE
SKTIIENVAREPEIQDLQNFLNKAGAKIKGAGTDRIEIEGVEKLHGIEYHIIPDRIEAGT
YLLAGVSTRGRVKVSNVIPEHLEALLKVLDELGVSITCDKNSIEVSVSGELKPIRVSTAP
YPGFPTDLQPMLTAVLCTVPGESIIEEKVFENRFGYVDEMNRMSANIKVMNRVAHIVGVE
KLSGAQIYAPDIRATAGMLIAALSAEGQTVIKNAAHIFRGYEKLKEKFTTIGAQIEVYPE
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaaattgtcgtagaaggtggcaggaaattaatcggcgaagtaccaatcagcggc
tcaaaaaatgcggcacttcccattctggcagctgccgttatgatagatgaaccggttgta
ttggacaatgtaccggaactcaaagatgttttcacaatgctaaccattctccaaagaatc
gggaagaaggtgtctttcagggataatagggttgttgtggaaccggggaatgttcttatg
ggagatgtcccttacgaattggttaggatgatgagggcttctttcaacgttcttggcccg
ctgacaatggtatgtggatgggcgaaagttgggaagccgggtggctgcaatataggtcaa
agaccagtggactttcacattgaaggtttgaaggctttaggatttttgataaaagaggaa
catggtgatgtcatagcgaaaaaaccctcgagttttaaggaagaactttattataaactg
ccttttccgagtgttggtgctacggaacagttaatgaccgtagcggcactcatgtcagaa
agtaagacgataatagaaaacgtcgccagagaacctgaaatacaggaccttcagaatttt
ctcaacaaagcaggtgcgaagattaaaggtgcaggaaccgatagaatagaaattgagggt
gtggagaaacttcatggaatcgagtatcacattatacccgacagaatagaagcgggaact
tatttacttgcaggtgtttcaaccagaggcagagtgaaagtctcaaatgtgataccggaa
catctcgaagccttgctgaaagtgctggatgagcttggagtaagtataacttgcgataaa
aatagtatagaggtttctgtttctggcgagctaaagccaattcgtgtttccacggcacct
tatcctggttttccaacggatttgcagccaatgctcacagctgtactctgtacagttccg
ggagagtcgataatcgaagagaaggtttttgaaaacaggtttggttatgtagatgagatg
aacagaatgagtgcaaatataaaagtcatgaacagggtcgctcatatagtaggagtagaa
aaactgagtggagcccagatatatgcacccgatataagggcgactgccggcatgcttatt
gcagctctttcagcagaaggtcaaacagtgataaagaatgcagcgcatatatttagaggc
tacgaaaaattgaaagaaaaatttaccacgataggggcacagatagaggtatatcctgag
gagtga

DBGET integrated database retrieval system