KEGG   Kosmotoga olearia: Kole_1848Help
Entry
Kole_1848         CDS       T00914                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
kol  Kosmotoga olearia
Pathway
kol00230  Purine metabolism
kol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Kole_1848
Enzymes [BR:kol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Kole_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 ATPase_2 AAA_22 ABC_tran Thymidylate_kin RsgA_GTPase AAA cobW Zeta_toxin AAA_23 AAA_30 Trimer_CC T2SSE AAA_29
Motif
Other DBs
NCBI-ProteinID: ACR80530
UniProt: C5CGE9
Position
complement(1979849..1980481)
Genome map
AA seq 210 aa AA seqDB search
MRGTIYVVSGPSGAGKTSILKEVLKKIPNLTFSVSYTTRPKRPGEIDGEDYFFVSKEKFV
ELVNSGEFLEWAEVHGNLYGTSKSFVESKIEKGINIILDIDVQGALSVMKKLPDAVTIFI
CPPSFKDLKKRLDNRGTEKEKDRERRLKDAKWELSHISDFQYLVVNRTLNESVKQLEAVI
IAEQLRVDRIKDHMGLQDFFKESDNDVCDN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaggggaacaatttatgtagtctccggtccttccggagctggaaaaacatcaattttg
aaagaagtcctaaaaaaaatcccgaatcttacattttctgtttcttatacaacgcgcccc
aaaaggcctggagagattgatggggaagattactttttcgttagtaaagaaaaatttgtg
gaactggtaaatagtggggaatttcttgaatgggcggaagtccatggtaacctctacgga
acatcaaaaagtttcgttgagtcaaagattgaaaaagggataaacattatcctggatatt
gatgttcagggtgcattgtctgtgatgaaaaaacttcccgacgctgttaccatattcata
tgccctccatcattcaaagatctgaaaaagcgccttgacaaccggggcactgaaaaagag
aaagatcgggaaagaagactcaaagatgccaagtgggaattatcccacatttcagatttt
caatatctggtagttaacagaactttaaacgagtcggtaaaacaacttgaagcagtaata
atagcagaacaactgagagttgatagaataaaagatcatatgggactacaggacttcttt
aaggagagtgataacgatgtctgtgataattaa

DBGET integrated database retrieval system