KEGG   Kosmotoga olearia: Kole_2022Help
Entry
Kole_2022         CDS       T00914                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kol  Kosmotoga olearia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kole_2022
   01230 Biosynthesis of amino acids
    Kole_2022
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kole_2022
   00051 Fructose and mannose metabolism
    Kole_2022
   00562 Inositol phosphate metabolism
    Kole_2022
Enzymes [BR:kol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kole_2022
Exosome [BR:kol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kole_2022
  Exosomal proteins of bladder cancer cells
   Kole_2022
  Exosomal proteins of melanoma cells
   Kole_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2152456..2153205
Genome map
AA seq 249 aa AA seqDB search
MVAGNWKMNKSPTEAKLFAGLLASKIGKETVMDIVVFPPAIDIPFVVDVLKDTNIGVGVQ
NVHPKEKGAFTGETSLLMVKDLSVEYVLVGHSERRHIFGESDEFINEKVKAVLSAGLRPV
LCVGETLEEREKGLTKNVLERQIRLGLFGLEKEDVVNTVIAYEPVWAIGTGVVATPEQAE
EAMAFIRSLLGELYGMETAENVRILYGGSIKPENFDALIRLKNVDGGLVGGASLKESFIE
LVEIAKRYV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgctggtaactggaagatgaacaaatcccccacggaagctaaactttttgccggt
ttgctagcttcaaagattggaaaagaaacggttatggatattgtcgttttcccaccggca
atagatataccctttgttgttgatgtactaaaagacaccaatattggcgtgggagttcag
aatgttcacccgaaagaaaagggagctttcacaggagagacctcgttgctgatggttaaa
gatctcagtgtagaatatgttcttgttggtcattctgagcgcagacatatatttggagaa
agtgatgagttcatcaatgaaaaggtaaaagcggtattatccgcgggtttgaggcctgtt
ttatgtgttggtgaaacattggaagaacgtgaaaagggacttactaaaaatgtacttgaa
cgtcagataaggcttggactttttggtttagagaaagaggatgttgttaatacagtaata
gcatatgaaccagtatgggcaattggaacaggtgttgtggccaccccggaacaggcggag
gaagcaatggctttcataagatcgctgctcggggagctttacggtatggaaactgctgaa
aatgtacgaatactttatggcggtagtataaaaccagagaattttgatgcacttatacgc
cttaagaacgtggatggagggctcgtgggcggcgcgagtctcaaagaaagttttatagaa
ttagttgaaatcgcgaagcgttacgtatag

DBGET integrated database retrieval system