KEGG   Kosmotoga olearia: Kole_2075Help
Entry
Kole_2075         CDS       T00914                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kol  Kosmotoga olearia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kole_2075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kole_2075
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Kole_2075
Enzymes [BR:kol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Kole_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2202655..2203914
Genome map
AA seq 419 aa AA seqDB search
MIKYNYLLRCISCGKEYSPEEVEYTCPDCGPRLGTLEVIYDFSILKKRLKDARWSTFSER
GIWQFSDLLPLPENFDELIPPLLVGNTPLYRADKIAGKYGVAEVLVKDDGRNPTASFKDR
ASALAVVKAKEKGYNTVFCASTGNAASSLAGLTAAAGLKSVIFVPASAPAAKLTQLQVYG
AKVLAIDGSYDEAFDISMIVGMEKGWYCRNSAINPYLLEGKKTGALELAVQTGMDLPDFV
FVSVGDGTVLSSFYKAFMDLKELGIIERIPTIVGVQAENASAIIDTYERGEPFTPADLDA
HSVADSIAVGKPRDVIKACKYTKKNGGLFVKVSDKEILDSIIELARGTGVFAEPAGATAF
AGFKRMKSLGQISESARVALIVTGNGLKDLKAPARVLEELKKLPANVEKIREGLDEDKL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
ttgattaagtacaactacttgcttcggtgtataagctgtggaaaggaatattcaccagag
gaagttgaatacacttgccctgattgcggaccaagactgggaacacttgaagttatatac
gatttttcgattctgaaaaaaaggctgaaagatgcccgttggtcaacgttttctgaacgc
gggatctggcaattttccgacctacttcctcttcccgaaaattttgacgaacttatacct
ccgcttcttgtggggaacacacctttgtatagggctgataaaattgcaggaaaatatggc
gttgctgaggtcctggtaaaggatgatggaagaaacccgacagcttcctttaaggacaga
gccagtgcccttgctgttgttaaagcaaaggaaaaaggttacaataccgttttttgtgcc
tcgacaggcaacgcagcgagttctctggcagggctcaccgctgccgcgggcttgaagagc
gttatctttgttcccgcgtcggcaccagcagccaaactgacccagctgcaggtatacggt
gcaaaggttctcgcgatagatggtagttacgatgaagccttcgatatatcgatgatcgtc
ggtatggaaaaaggttggtattgcagaaacagtgcgataaatccctatctacttgaagga
aagaaaacaggtgcgcttgagcttgcggtacaaacgggaatggatcttcctgactttgtc
ttcgtttctgtcggtgatggtaccgttttgagcagtttctataaggcctttatggatttg
aaggaacttggaatcatcgaaaggattccaacgatcgtaggtgttcaggccgagaatgct
tccgccattatagatacatacgaacgtggagagcctttcacacctgctgatttagacgca
catagcgtagcggatagcattgctgtaggcaagccaagagacgtaataaaagcctgtaag
tatacaaaaaagaacggtggcctctttgtgaaggtttcagataaggaaatcctggatagt
ataatcgaacttgcaaggggaaccggcgtttttgctgaaccggcgggagcaactgctttt
gcaggattcaaacgaatgaaaagtcttggtcagatttcggaaagcgcaagagtagctttg
attgttaccggaaatggccttaaagatttgaaagcacctgctcgggttctcgaagagctt
aaaaagcttcctgctaacgttgagaaaatcagggagggattggatgaagataagctttaa

DBGET integrated database retrieval system