KEGG   Klebsiella oxytoca M1: HR38_00220Help
Entry
HR38_00220        CDS       T03349                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kom  Klebsiella oxytoca M1
Pathway
kom00052  Galactose metabolism
kom00500  Starch and sucrose metabolism
kom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kom00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HR38_00220
   00500 Starch and sucrose metabolism
    HR38_00220
Enzymes [BR:kom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     HR38_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIE66939
Position
complement(53552..54985)
Genome map
AA seq 477 aa AA seqDB search
MTYSISRAEQELQAKHEQLNLRWYPRYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
KWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PSDEANLYQVQCLATSRDGIHFERQGIVVDTPPGMHHFRDPKVWREEDSWYMIVGARDGD
TGQVRLYRSADLRQWQDAGVLDEAEKEMGYMWECPDFFALNGKHILMFSPQGLAAKGYQN
RNLFQSGYLLGEWRPGQAFVREGEFVEMDHGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADNRLQMRPAKEVESMRGASFPWPVTTLKNQQTTMVENCE
AMEVILHWDGLNSSAEQYGLSFGEGLRVYVDAQMQRLVLERHYPQYGLCGTRSVPLNEGA
DLKLRIFFDSSSVEVFVNDGEACLSSRIYPDADRRELSLFAWNGSAYLTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcaatttcccgggctgagcaagaactgcaggctaaacatgaacagctgaac
ctgcgctggtatccgcgctatcacctggccgcccgcgcgggctggatcaacgatcccaat
ggcctggtctggtttgacggctggtaccacgcgttttaccagcaccatccgtactccacc
aaatgggggccgatgcactggggtcacgcgcgcagtaaagatctggtgcactgggaacat
ctgccggtggcgctggccccggaaggccccgaggataaagacggctgcttctccggctcc
gcggtggtggatggcgatacgctggcattgatttataccgggcataaatttcatggcgat
cccagcgatgaagccaacctttatcaggtgcaatgtctggccaccagccgcgacgggatt
cacttcgagcgccaggggatcgtggtcgacaccccgccgggcatgcaccatttccgcgac
ccgaaagtgtggcgagaagaggacagctggtacatgatcgtcggcgctcgcgatggcgac
accggccaggtgcggctgtatcgttcagccgatctgcgccagtggcaggacgccggcgtc
cttgacgaggcggaaaaagagatgggctacatgtgggaatgcccggatttcttcgccctc
aacggcaagcatattctgatgttctccccgcaggggctggcggctaaaggctatcaaaac
cgcaacctgttccagagcggctatctgctcggtgaatggcggccggggcaggcgtttgtg
cgtgagggcgagtttgtggaaatggatcacggccacgacttttatgccccgcaaagcttc
ctcactcccgacggccgccgcattgtcatcggctggctggatatgtgggagtcgccgctg
ccggagcagcaggatggctgggcaggcatgctgtcgctgccgcgtgaactgagcctgagc
gcggataatcgactgcagatgcgtccggcgaaagaggtcgagagcatgcgcggcgccagc
ttcccgtggccggtgacgaccctgaaaaaccagcagaccacgatggtggagaactgcgaa
gcgatggaggtgatcctgcactgggatggcctgaacagcagcgccgagcagtatggcctg
agcttcggcgaaggtctgcgcgtttacgtggatgcgcagatgcagcgcctggtgctcgag
cggcactatccgcagtatggcctgtgcggcacccgcagcgtcccgttgaacgaaggcgcc
gatctgaagctaaggatattcttcgatagctcttccgtcgaagtgtttgttaatgatggc
gaggcctgtcttagcagtcgtatatatccggatgccgatcgtcgcgaattgtctttattt
gcctggaacggttcggcttatttaaccgaagccggcgcctggcagctggaataa

DBGET integrated database retrieval system