KEGG   Candidatus Kinetoplastibacterium oncopeltii: CONE_0428Help
Entry
CONE_0428         CDS       T02471                                 

Definition
uroporphyrinogen-III synthase uroS (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kon  Candidatus Kinetoplastibacterium oncopeltii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CONE_0428
Enzymes [BR:kon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CONE_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237668..238465
Genome map
AA seq 265 aa AA seqDB search
MLSKKVFILTRPNNNKILSDSLSSIGFKSLSLPSLRIEPLDLHNVPSPEIYDFIFFSSSN
AVRSYLVQINKTYGLIKKWPLKTSVVTVGNATADSFRSSGFVNIDLLTILNPDDSKAKLD
SESLWEVLKKQNLYGKRFLFVRGNKGRDWLVNKVSEYCEVDLCSVYCRDNIQWSQHDSDQ
LKKISQETPIVIWLFTSIESIKATIDNIVFLNLSNWFNSCKFIVTHERIYDFLLNYLIEC
GVSDKLVIKDCLPYNESIIKACVDI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctttccaaaaaagtttttattttaacaagaccaaacaataataaaatactatctgat
agtctcagcagtattggttttaagtctttatctcttccttctttaagaattgaacctttg
gatttgcataatgttccttcgccagagatctatgattttatttttttttcaagtagtaat
gctgttagatcttatctagttcaaataaataaaacttatggccttataaagaagtggcct
ctcaaaacttcagtagttacagtaggtaacgcaactgctgatagttttcgttcttctggt
tttgttaatatagatttattaacaatattgaatcctgatgattctaaggcgaaactagat
tccgaatctctatgggaagttctaaaaaagcagaatttatacggtaaaagatttcttttt
gttagaggaaacaaaggtagagattggcttgttaataaagtttctgagtattgtgaagtg
gatctatgttctgtatattgtagagataatatacaatggtctcaacatgattcagaccaa
ttaaaaaaaatttctcaggaaactcctatagtcatatggctattcactagtatagaaagt
ataaaagctactattgataatatagtttttttaaatcttagtaactggtttaatagttgt
aaattcatagttacccatgaaagaatttatgattttttattaaattatttaatagaatgt
ggagtttcagataagcttgtcataaaagattgtttgccttataacgaatctattattaag
gcatgtgttgatatttag

DBGET integrated database retrieval system