KEGG   Kosakonia oryzae: AWR26_00190Help
Entry
AWR26_00190       CDS       T04433                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kor  Kosakonia oryzae
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:kor00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWR26_00190
   00630 Glyoxylate and dicarboxylate metabolism
    AWR26_00190
   00640 Propanoate metabolism
    AWR26_00190
   00650 Butanoate metabolism
    AWR26_00190
  Lipid metabolism
   00071 Fatty acid degradation
    AWR26_00190
   00072 Synthesis and degradation of ketone bodies
    AWR26_00190
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AWR26_00190
   00310 Lysine degradation
    AWR26_00190
   00380 Tryptophan metabolism
    AWR26_00190
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AWR26_00190
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AWR26_00190
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AWR26_00190
Enzymes [BR:kor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AWR26_00190
Exosome [BR:kor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWR26_00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
38453..39640
Genome map
AA seq 395 aa AA seqDB search
MKDTDIVILGAARTAIGSLNGSLANISSPKLGSIVIKSLLEKSHISEKEVDEVIIGQVLT
AGCGQNPARQTLIHSGISQDVPALTINKVCGSGMKALQLAYQSLKCGEAELIIAGGQENM
SQSPHILPHSRNGMKMGNWQMQDSMVNDGLWDAFHDYHMGMTAENIAEKYGITREEQDEF
ALASQRKAAAALETSRFDSEIAPVVIIKPGKEPIVVEKDEFPRPQTTREGLAKLRPAFKK
EGTVTAGNASGVNDGAAMVILATAKKARELGITPLGRVVEFATSGVAPEIMGTGPIEASR
NVLKKSNWQVSNLDLIEANEAFAAQAIAVNREMGWDLTKVNVNGGAIALGHPIGASGARI
FVSLIHEMQRRKSKKGLATLCIGGGMGIAVTVEMD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacactgatattgttatacttggtgcagcaaggacagctattggctcgcttaat
ggttcccttgccaatatatcttcacctaaactgggatctatagtgattaaatcacttctt
gaaaaatctcatatttcagaaaaagaggtggatgaagtaatcattggtcaggttttaacg
gcggggtgtgggcaaaatccagcgcgacaaacattaattcattccggtatttcacaggat
gttcccgcgctgacaattaataaagtttgtggctcaggaatgaaagcattacagcttgca
tatcagtcattaaagtgcggtgaagcggagctgattattgcgggcgggcaagaaaatatg
agtcagtcgccgcatattctccctcactcccgtaatggaatgaaaatgggcaactggcaa
atgcaggacagcatggttaatgatggattatgggacgcattccatgattatcacatgggg
atgaccgcggaaaatatcgcggagaaatatggcattacgcgtgaagagcaggatgaattt
gcgctggcctcacagcgtaaagccgctgcggctcttgagacttcccgttttgacagcgag
attgcgccggttgttattatcaaacccggtaaagaacccatcgtagttgaaaaagatgaa
tttccgcgtccgcaaactacgcgtgaagggctggcaaaattacgcccggctttcaagaaa
gagggaaccgtaaccgccggcaacgcttccggggtaaatgatggcgcggctatggttatt
ttggctactgcgaaaaaagccagagaactgggtattacgccgcttggccgggtcgttgaa
tttgcgacctcaggcgttgcaccggaaataatgggaaccgggccgattgaagcttcccga
aatgtacttaaaaaatcaaactggcaggtcagcaatcttgatctcattgaagccaatgaa
gcgtttgcggcgcaggctatcgcggttaatcgagaaatgggctgggatctgacgaaagtg
aatgttaatggcggcgccattgctctcggtcaccctattggcgcgtctggcgcccgtatt
tttgtgtcgttaattcatgaaatgcagcgccggaaaagtaaaaaaggtctggcgacatta
tgcattggcggcggcatgggtattgctgtcacggttgagatggattaa

DBGET integrated database retrieval system