KEGG   Klebsiella oxytoca KCTC 1686: KOX_00245Help
Entry
KOX_00245         CDS       T01681                                 

Definition
hypothetical protein
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kox00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61686..62636
Genome map
AA seq 316 aa AA seqDB search
MDNVFHQPQGGNEMPRFGGRATMMRLPFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRTESVMIRPYNMATGAAPFDSLSVADIGDVPINTYNLLKSVQIIEDYYTGLNSFPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDRGFRLVQAEQCWHKSLTPLMAEVRQQMGAGPVYLSFD
IDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGCDLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtctttcatcaaccgcagggtggcaacgagatgccgcgttttggtggccgc
gccacgatgatgcgcctgccatttatcgaagatttacagggacttgatgcagcgtttgtc
ggcatcccgctggatatcggaacctcacagcgttccggaacgcgctacggaccgcgctat
attcgtaccgaatcggtaatgattcgcccgtataacatggccaccggcgccgcgcctttt
gattccttgtcggtggcagatatcggtgatgtaccgatcaatacctacaacctgctcaaa
tcggtgcagattatcgaggattactacaccggtttaaatagttttccgcttatccctctg
acgctgggaggcgatcacaccattaccctgccgatcctgcgcgcgctgaccaaaaagcac
ggtccggttgggctgattcacgtcgatgcccacacagataccaacgatgaaatgttcggc
gaaaagattgcccacggcaccaccttccgccgcgccgtcgaagaggggctgctggatctt
aaacgcgtcgtgcagattggccagcgcgcgcagggctacgccgccggtgacttccagtgg
ggcgtcgatcgcggttttcgtctggttcaggccgagcagtgctggcacaaatctttgact
ccgctaatggccgaagtgcgccagcaaatgggggctggcccggtttatctcagcttcgat
attgatagcctcgacccgatctgggcccccggcaccggaactccggaagtgggcggactg
acgtcgattcaggcgctggaaatcgtgcgcggctgccgcggtctgaacctgattggctgc
gacctggtcgaggtctcgcccccctatgacgtcagcggcaacacgtcccagctggccgcc
aacctgctgtatgaaatgctctgcgttctcccgggcgtgaaatatccatag

DBGET integrated database retrieval system