KEGG   Klebsiella oxytoca KCTC 1686: KOX_00320Help
Entry
KOX_00320         CDS       T01681                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
kox  Klebsiella oxytoca KCTC 1686
Brite
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     KOX_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(74965..76359)
Genome map
AA seq 464 aa AA seqDB search
MKKIATITASVITAGVLCYLGLSGYIWYYDSQRIKKNDVRLSAVAENNKVLSFFSEKGCD
YCHTPSAELPFYAAFPVAKQLMDYDVQLGYKSFNLQSVRTSLIDDKPVSQSELNKIEWVM
QHQTMPPTRYVALHWAGGVSDSERIEILNWIKHQRERYYASADTAAQHRNEPLQPIPKKL
PVDERKAALGFRLYHDARMSGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRASTLQEQAGGPPLNPIEMASKSWGDIINKLDKDPVLKKDFLAVYPQG
FSGERITDAIAEFEKTLITPDAPFDNWLRGDEDALTAQQKHGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKRDFNFGEITAADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGTDLAQKDIDDIVAFLHSLTGVYTPYQPGQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcgaccattacagcctcggtcattaccgcaggcgtgttatgttattta
gggttgtcaggctatatctggtattacgacagtcagcgtattaaaaaaaacgacgtccgg
ctctcggcggttgccgagaataataaagtcctctctttttttagtgaaaaaggttgcgac
tattgccataccccctcggcggagttgcccttttacgccgcttttcccgttgccaaacag
ctgatggattatgacgtacagctgggatacaaatcctttaaccttcaatccgtgcgtacg
tcactgattgacgataaacccgtttcacaaagtgaattaaacaagattgagtgggttatg
cagcatcaaacgatgccgcctacgcgatacgtcgcgctgcactgggccggcggcgttagc
gacagcgaacgtattgagatactcaactggattaagcaccagcgcgagcgctactacgcc
agcgctgataccgccgcgcagcatcgcaatgaacctctccagccgatccctaaaaagctg
cccgttgatgagcggaaagctgcgctgggttttcgtctttatcacgacgcgcgaatgtcc
ggggatagcactatttcttgcgcacactgtcatgcgttaaacgcgggcggggtcgatggc
agaaaaacgtctatcggcgtggggggcgctgttgggccaattaacgcgccaacggtattt
aactccgtctttaatattgagcaattctgggacggacgggcatcaacgctgcaagaacag
gccggtggcccgccgttaaaccccattgagatggcatcaaaatcctggggagacattatt
aataaactggataaagatcccgtattgaaaaaggattttttagccgtttatccgcaaggt
tttagcggtgagcgcatcactgacgctatcgctgaatttgaaaaaacattaattaccccc
gacgcgccatttgataattggctgcgcggtgatgaagacgcgctgaccgcgcaacaaaaa
catggctatcagctatttaaagataataaatgtgctacctgtcacggcggtattattctc
ggcggccgctcttttgaaccgctggggctgaagcgtgattttaattttggtgaaatcacg
gctgctgatattggccgaatgaatgtgacgaaagaggtacgggataaattacgccaaaaa
gtgccgggtctgcgcaacgtggcgctcaccgcgccctattttcatcgcggtgatgttccg
acgcttgatggcgcagtaaaactgatgctgcgctatcaggtcggtacggatttagcgcaa
aaagatatcgatgatattgtcgcttttctgcatagcctgaccggtgtttatacgccgtat
cagccggggcaataa

DBGET integrated database retrieval system