KEGG   Klebsiella oxytoca KCTC 1686: KOX_02465Help
Entry
KOX_02465         CDS       T01681                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_02465
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KOX_02465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520671..522104
Genome map
AA seq 477 aa AA seqDB search
MKKIPLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTGGAHGVPREITQQVEPGKYYP
NHEAIDFHGRYKEDIKLFAEIGFKCFRTSIAWTRIFPLGDESQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARQINPEMQVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNINMEDGDAQ
ILREGTCAYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPHVKASDWGWQIDPVGLRYAL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHVEEMIKAVTYDGVELMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattcctttaccaaaagactttttatggggtggcgccgtcgccgcgcaccag
gttgaaggcggctggaataaagacggcaaaggcccgagcatctgcgacgtgcttaccggc
ggcgcgcacggcgtgccgcgcgagataacccagcaggtagagccgggcaagtactatccg
aaccacgaagccatcgatttccacggccgctacaaagaagacatcaagctgttcgccgag
ataggcttcaagtgcttccgcacctctatcgcctggacgcgcatcttcccgctgggcgac
gaaagccagccgaatgaagaagggctgaaattctacgatgacatgttcgatgaactgctg
aagtacaacatcgaaccggttattaccctctcccactttgagatgccgctgcatctggtt
cagcagtacggcggctggaccaaccgcaaagtggtcgatttctttgtgcgcttcgccgaa
gtggtcttcgagcgctataagcacaaagtgaaatactggatgacctttaacgagatcaac
aaccagcgtaactggcgcgcgccgctgtttggctactgctgctccggcgtggtctatacc
gagcatgaaaacccggaagagaccatgtaccaggtgctgcaccatcagtttgtcgccagc
gcgctggcggtgaaggcagcgcgtcaaatcaatccggagatgcaggtgggctgcatgctg
gcaatggtcgccctctatccgttctcctgcaagccggaagacgtgatgtttgcccaggaa
tcaatgcgtgaacgctacgtctttaccgacgtccagctgcgcggctactacccgagctac
gtcctgaacgaatgggaacgccgcggcttcaatatcaacatggaggacggcgatgcgcaa
atcctgcgcgaaggcacctgcgcgtatctcggcttcagctactacatgaccaacgcggtg
aaagcggaaggcggcaccggcgacgcgatctccggctttgaaggcagcgtgcccaacccg
cacgtcaaagcctccgactggggctggcagattgacccggtcggcctgcgctatgcgctg
tgtgaactgtatgagcgctaccagaagccgctgtttatcgtcgaaaacggcttcggcgcg
tacgataaagtcgaggaagacggcagcatcaacgacgactatcgcatcgactatctgcgc
gctcacgtcgaagagatgatcaaagcggtgacttacgacggcgttgagctaatgggctat
accccgtggggctgcatcgactgcgtctccttcacgaccggtcagtacagcaagcgctac
ggctttatctacgtcaacaaacatgacgatggtaccggcgatatgtcccgctcgcgcaag
aagagctttaactggtacaaagaggttatcgccagcaacggcgagaaactgtaa

DBGET integrated database retrieval system