KEGG   Klebsiella oxytoca KCTC 1686: KOX_05080Help
Entry
KOX_05080         CDS       T01681                                 

Definition
UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Orthology
K07806  
UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Two-component system
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kox00520]
Environmental Information Processing; Signal transduction; Two-component system [PATH:kox02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046191..1047330)
Genome map
AA seq 379 aa AA seqDB search
MSDFLPFSRPSMGDAELAALREVLQSGWITTGPKNQALEEAFCTLTGNRHAIAVSSATGG
MHVTLMGLGIGAGDEVITPSQTWVSTLNMICLLGATPVMIDVDPDNLMITPEAVEAAITP
RTKAIIPVHYAGAPADIDAIRAIGERHAIPVIEDAAHAAGTYYKGRHVGWRGTAIFSFHA
IKNMTCAEGGLVVTDDDELAARIRSLKFHGLGVDAYDRQTLGRAPQAEVISPGFKYNLAD
INAALALVQLDKLAHANQRRAAIAQRYLRELADTPFRPLVAPSWEHQHAWHLFIIRVDEA
ACGISRDALMERLKAMGIGTGLHFRAAHTQKYYRERFPEVSLPHTEWNSARICSIPLFPD
MTDDDVTRVISALHQLSGR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattttttgccgttttcgcgcccgtcgatgggcgacgcagagctggctgcgctg
cgtgaagttttgcaatcgggctggatcaccactggaccgaaaaatcaggcgctggaagag
gcgttctgcacgttaaccggcaaccgtcacgccatcgccgtcagttcggcgaccggcggc
atgcacgtcacgctgatggggctgggtatcggtgcgggtgatgaagtgatcaccccttcc
cagacctgggtctccacgctgaacatgatctgcctgctcggcgcgaccccggtgatgatc
gatgtcgatcccgataacctgatgattacccccgaagcggttgaagcggcaatcaccccg
cgaaccaaagccattatccctgtgcactatgctggcgcaccggcggatattgacgccatt
cgcgcgattggcgagcgtcacgctattccggtgattgaagatgccgcccacgcggcgggg
acgtactacaaaggccgccacgtcgggtggcgcggtaccgccattttttcattccatgcg
atcaagaatatgacctgcgccgaaggcgggctggtggtaaccgacgatgacgagctggcc
gcgcgcattcgcagcctgaagttccacggcctcggcgttgacgcttatgaccgccagacc
ctgggccgcgcgccgcaggcggaggtgatttcgccgggctttaaatacaatctcgcggat
atcaacgccgcgctggcgctggtgcagctggataagctcgcccacgccaatcagcgccgc
gccgccattgcgcaacgctatctgcgcgagctggcggatacgcccttcaggccgctggtg
gcgccgtcgtgggagcatcagcacgcctggcacctgtttattatccgcgttgacgaagcc
gcctgcggcatcagccgcgatgcgctgatggaaagactgaaggccatgggcattggcacc
ggcctgcacttccgcgcggcccatacgcaaaagtattaccgcgagcgtttccctgaagtt
tcattaccgcatacggaatggaacagcgcgcgcatttgttccattccgttgttcccggat
atgaccgatgacgatgtcactcgggtcatttccgcactgcaccagctgtcaggacgttga

DBGET integrated database retrieval system