KEGG   Klebsiella oxytoca KCTC 1686: KOX_05080Help
Entry
KOX_05080         CDS       T01681                                 

Definition
UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Orthology
K07806  
UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Two-component system
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KOX_05080
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KOX_05080
Enzymes [BR:kox01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     KOX_05080
Lipopolysaccharide biosynthesis proteins [BR:kox01005]
 Unusual sugar
  KOX_05080
Amino acid related enzymes [BR:kox01007]
 Aminotransferase (transaminase)
  Others
   KOX_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046191..1047330)
Genome map
AA seq 379 aa AA seqDB search
MSDFLPFSRPSMGDAELAALREVLQSGWITTGPKNQALEEAFCTLTGNRHAIAVSSATGG
MHVTLMGLGIGAGDEVITPSQTWVSTLNMICLLGATPVMIDVDPDNLMITPEAVEAAITP
RTKAIIPVHYAGAPADIDAIRAIGERHAIPVIEDAAHAAGTYYKGRHVGWRGTAIFSFHA
IKNMTCAEGGLVVTDDDELAARIRSLKFHGLGVDAYDRQTLGRAPQAEVISPGFKYNLAD
INAALALVQLDKLAHANQRRAAIAQRYLRELADTPFRPLVAPSWEHQHAWHLFIIRVDEA
ACGISRDALMERLKAMGIGTGLHFRAAHTQKYYRERFPEVSLPHTEWNSARICSIPLFPD
MTDDDVTRVISALHQLSGR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattttttgccgttttcgcgcccgtcgatgggcgacgcagagctggctgcgctg
cgtgaagttttgcaatcgggctggatcaccactggaccgaaaaatcaggcgctggaagag
gcgttctgcacgttaaccggcaaccgtcacgccatcgccgtcagttcggcgaccggcggc
atgcacgtcacgctgatggggctgggtatcggtgcgggtgatgaagtgatcaccccttcc
cagacctgggtctccacgctgaacatgatctgcctgctcggcgcgaccccggtgatgatc
gatgtcgatcccgataacctgatgattacccccgaagcggttgaagcggcaatcaccccg
cgaaccaaagccattatccctgtgcactatgctggcgcaccggcggatattgacgccatt
cgcgcgattggcgagcgtcacgctattccggtgattgaagatgccgcccacgcggcgggg
acgtactacaaaggccgccacgtcgggtggcgcggtaccgccattttttcattccatgcg
atcaagaatatgacctgcgccgaaggcgggctggtggtaaccgacgatgacgagctggcc
gcgcgcattcgcagcctgaagttccacggcctcggcgttgacgcttatgaccgccagacc
ctgggccgcgcgccgcaggcggaggtgatttcgccgggctttaaatacaatctcgcggat
atcaacgccgcgctggcgctggtgcagctggataagctcgcccacgccaatcagcgccgc
gccgccattgcgcaacgctatctgcgcgagctggcggatacgcccttcaggccgctggtg
gcgccgtcgtgggagcatcagcacgcctggcacctgtttattatccgcgttgacgaagcc
gcctgcggcatcagccgcgatgcgctgatggaaagactgaaggccatgggcattggcacc
ggcctgcacttccgcgcggcccatacgcaaaagtattaccgcgagcgtttccctgaagtt
tcattaccgcatacggaatggaacagcgcgcgcatttgttccattccgttgttcccggat
atgaccgatgacgatgtcactcgggtcatttccgcactgcaccagctgtcaggacgttga

DBGET integrated database retrieval system