KEGG   Klebsiella oxytoca KCTC 1686: KOX_05320Help
Entry
KOX_05320         CDS       T01681                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
kox  Klebsiella oxytoca KCTC 1686
Brite
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KOX_05320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094555..1094983
Genome map
AA seq 142 aa AA seqDB search
MSPTIPPLSLHGLEFIKRMQGLALAPYRDESGLRVIGYGHVLNDYESFPHFTREIAETLL
IVDLLQCQRELKRRLRVTLNQAQYDALVSLAFSCGAASPALDTVLTHLNHQRFADALSAW
ENIRIGREQRREECARFKNRAD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaaccataccgccgctaagcctgcacgggctggagtttattaagcgaatgcag
gggttagcgctcgccccctatcgggacgaaagcggcctgcgcgtgattggctacggccac
gttctcaatgattacgaatcgttccctcacttcacgcgcgagatcgcggagactctgctt
atcgtcgatcttctgcagtgccagcgcgaacttaagcgcaggctccgggtcacgcttaat
caagcgcaatatgatgcgctggtctcgttagcctttagctgcggggcggcgtctccggcg
cttgataccgtcctgacccatcttaaccatcagcggttcgctgatgcgctgagcgcatgg
gaaaatattcgcatcggccgcgaacagcggcgcgaagagtgcgcaagattcaaaaacaga
gccgattaa

DBGET integrated database retrieval system