KEGG   Klebsiella oxytoca KCTC 1686: KOX_05385Help
Entry
KOX_05385         CDS       T01681                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KOX_05385
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KOX_05385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1113111..1114217)
Genome map
AA seq 368 aa AA seqDB search
MNAVRGVVLSVLMLAAAQVSAACQWPAWEQFKKEYVSAEGRIIDPSDARKITTSEGQSYG
LFFALAANDRDGFRKLFEWTQNNLAEGDLRAHLPGWLWGKKSDDEWTVLDNNSASDSDLW
IAWALLEAGRLWDTPQYTEVGKALLARIADEEVATVPGLGPMILPGRVGFVDDRGWRFNP
SYLPPQLATYFAAFGAPWPKIRDGNLHLLLETAPKGFSPDWVRYEKSKGWQLKADKPIIG
SYDAIRVYLWVGMLDDGDKQKARLLARFKPMATRTIDQGVPPEKTNIATGKTTGNGPVGF
SAALLPFLQKEDARAIQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTAGGELRPDW
NQECTSSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtgcgcggtgtggtgttatcggtattgatgctggcggcggcgcaggtgagc
gccgcctgccagtggccggcctgggagcagtttaaaaaagagtatgtcagcgccgaaggg
cgaattatcgaccccagcgatgcgcgaaaaatcaccacctcggaagggcaaagctacggg
ctgttctttgctctggcggctaacgatcgcgacggcttccgcaagctgttcgagtggacg
caaaacaaccttgccgagggcgatttgcgcgcgcatctcccgggctggctgtgggggaaa
aagagcgatgacgagtggacggtgctggacaacaattcagcctcggactccgatttgtgg
atagcctgggcgctgctggaggccggacgtctgtgggacacacctcagtacaccgaggta
ggcaaggcgctgctggcgcgcattgccgacgaagaggtcgccaccgtaccggggctgggg
ccgatgattctgccggggagagttggcttcgtcgatgaccgcggctggcgttttaatccc
agctatctgccgccgcagctggcgacctactttgccgcgtttggcgctccctggccgaag
atacgcgacggcaatctgcatctgctgctggaaaccgcgccgaaaggtttttcgcctgac
tgggtgcgttacgaaaaaagcaaaggctggcagctgaaagcggataaacccattatcggc
agctatgacgccattcgcgtctatctgtgggtcggtatgctcgatgacggcgataagcaa
aaagctcgcctgttggcgcgttttaaaccgatggcgacccggacgattgaccagggcgtg
ccgccggaaaaaaccaacatcgcgaccggtaaaactaccggcaacggtccggttggcttc
tccgctgcgctactgcctttcttgcagaaggaagatgcgcgcgccattcagcgccagcgc
gtcgccgataactatcccggcgcggatgcttactacagcgcggtcctgacccttttcggc
cagggatgggatcaacaccgttttcgcttcaccgccggtggcgaattacggcctgactgg
aaccaggaatgcacaagttctcactaa

DBGET integrated database retrieval system