KEGG   Klebsiella oxytoca KCTC 1686: KOX_05440Help
Entry
KOX_05440         CDS       T01681                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kox00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1125966..1126922)
Genome map
AA seq 318 aa AA seqDB search
MMLPHAWADTAWESYKSRFMMPDGRIIDTGNGNVSHTEGQGFAMLLAVANNDRSAFDKLW
QWTDKTLRNKDNGLFYWRYNPVAPNPVADKNDATDGDTLIAWALLRAQQQWHEKSYGSAS
DAITASLLKSTVVTFAGRQVMLPGAKGFYLNDHLNLNPSYFIFPAWQAFAARTHLTAWRK
LQSDGQALLGKMAWGKSQLPSDWVALRADGKMEPAKEWPTRMSFDAIRIPLYVYWSDPKS
SLLTPWKNWFQRYPRLQTPAWINVNTDEVAPWFMTGGLLAVRDLTLGEAQADPQITPQDD
YYSASLKLLVWLANKDQA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttccccacgcgtgggccgatacggcgtgggaaagctataaatcgcgttttatg
atgccggacggacgcattattgataccggcaacggcaacgtctcccataccgaagggcaa
ggttttgccatgctgttagcggtggccaataacgatcgctccgcctttgacaagctatgg
cagtggaccgataaaaccctacgcaacaaagataacgggttgttttactggcgctataac
ccggtggcgcccaatccggtggcggacaaaaatgacgccaccgatggtgataccctgatt
gcctgggcgctgctgcgcgcgcagcagcagtggcatgaaaaatcctacggcagcgcgtcg
gatgcgataaccgcttcgctcctgaagtctacggtggtcacgtttgccggtcgtcaggtg
atgcttccgggcgcaaagggattctatctcaacgaccacctgaatcttaatccctcctac
tttatctttccggcgtggcaggccttcgccgcgcgtacgcatttaaccgcctggagaaag
ctgcagagcgatggccaggcgctgctggggaaaatggcgtgggggaaatcgcagcttccc
agcgactgggtggccttaagagcggacggtaagatggagccggcaaaagagtggccgacg
cgaatgagcttcgatgcgatccgtattccgctgtatgtctactggagtgacccgaaaagc
agcctgctgacgccgtggaaaaactggttccagcgctatccgcgtctgcagacgccggcg
tggataaacgtgaataccgatgaagtggcgccgtggtttatgaccggcgggctgctggcg
gtacgcgatttaacccttggcgaagcgcaggccgatccgcagattacgccgcaggacgac
tattactccgccagcctgaagctgctggtatggctggcaaataaagaccaggcgtaa

DBGET integrated database retrieval system