KEGG   Klebsiella oxytoca KCTC 1686: KOX_05625Help
Entry
KOX_05625         CDS       T01681                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KOX_05625
   00051 Fructose and mannose metabolism
    KOX_05625
Enzymes [BR:kox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     KOX_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1171913..1173235)
Genome map
AA seq 440 aa AA seqDB search
MQTYFDQLDRVRYEGPKSANPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGSFNRPWQQPGEALEMAKRKADVAFEFFQKLNVPYYCFHDVDVSPEGASLKEYANNFA
QMVDVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMDATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHTFHHEIATAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMIEDGELDKRVARRYAGWNGELGQQILKGQMNLADIAQYATQHNLAPE
HQSGHQELLENVVNRYLFDR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctattttgatcagctcgatcgcgttcgttatgaaggcccgaaatccgctaac
ccactggctttccgtcattacaatccggatgagctggtcctgggcaaacggatggaagag
cacctgcgctttgcggcctgctactggcacaccttctgctggaacggcgctgatatgttc
ggcgtgggctcctttaaccgcccgtggcagcagccgggcgaagcgctggaaatggcgaaa
cgcaaagccgatgtcgcgtttgagtttttccaaaaactaaacgtaccgtattactgcttc
cacgacgttgacgtttctccggaaggggcgtcgttgaaagagtatgccaacaacttcgcg
cagatggtggatgtgctggcggaaaaacagcagcagagcggcgtcaagctgctgtggggt
acggcaaactgctttacgaacccgcgttacggtgccggtgcggcaaccaacccggatccg
gaagtgttcagctgggcggccactcaggtggtgaccgcgatggatgcgacccacaaactg
ggcggggaaaactacgtcctgtggggcggccgcgaaggctatgaaactctgctcaatacc
gacctgcgccaggagcgcgagcagattggccgctttatgcagctggtcgtggagcataaa
cataaaatcggtttccagggcacgctgctgattgaacctaaaccgcaggagccaaccaag
catcagtacgattacgacgcgtctaccgtctatggcttcctgaaacagttcggcctggaa
aaagagatcaaactgaacatcgaagcgaaccacgcgacgctggccggccacactttccac
cacgaaattgcgaccgccattgctctgggtctgtttggttccgttgatgctaaccgcggc
gacccgcagctgggctgggataccgaccagttcccgaacagcgttgaagagaatgcgctg
gtgatgtacgaaatcctgaaagcgggcggcttcaccaccggcggcctgaactttgatgct
aaagtgcgtcgtcagagcaccgacaaatacgacctgttctacggccacattggcgcgatg
gacaccatggcgctggcgttaaaagtcgctgctcgtatgattgaagacggcgagctggat
aaacgcgtcgccaggcgctatgccggctggaacggcgagctgggtcagcagatcctgaaa
ggccagatgaacctggcggacattgcccagtatgccactcagcataacctggcgccggag
caccagagcggccatcaggaactgctggaaaacgtggttaaccgttacctctttgatcgc
taa

DBGET integrated database retrieval system