KEGG   Klebsiella michiganensis KCTC 1686: KOX_06045Help
Entry
KOX_06045         CDS       T01681                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00010  Glycolysis / Gluconeogenesis
kox00051  Fructose and mannose metabolism
kox00562  Inositol phosphate metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
kox01230  Biosynthesis of amino acids
Module
kox_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kox_M00002  Glycolysis, core module involving three-carbon compounds
kox_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_06045 (tpiA)
   00051 Fructose and mannose metabolism
    KOX_06045 (tpiA)
   00562 Inositol phosphate metabolism
    KOX_06045 (tpiA)
Enzymes [BR:kox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KOX_06045 (tpiA)
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KOX_06045 (tpiA)
  Exosomal proteins of bladder cancer cells
   KOX_06045 (tpiA)
  Exosomal proteins of melanoma cells
   KOX_06045 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AEX02942
UniProt: A0A0H3H5Q0
Position
1259094..1259861
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVTGCAVAIAPPEMYIDLAKQAAAGSHIH
LGAQNVDLNLSGAFTGETSAEMLKDIGAEYIIIGHSERRTYHKESDEFIARKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtcgcgaacctgcgtaccgaactggctggcgtaaccggctgtgcagttgccatt
gctccgcctgagatgtacatcgacctggctaaacaagccgctgcgggcagccacattcac
ctgggcgcgcagaacgttgacctgaacctgtccggcgcgttcactggcgaaacctctgcc
gaaatgctgaaagacatcggcgctgaatacatcatcatcggccactccgagcgccgtacc
taccacaaagagtccgacgagtttatcgccaggaaattcgcggtactgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacggaa
gaagtgtgcgcgcgtcagatcgacgccgttctgaaaacccagggcgcggcggcgttcgaa
ggcgcagttatcgcttatgagcccgtatgggcgatcggtaccggcaaatccgctaccccg
gctcaggctcaggctgtacacaaattcattcgcgaccacatcgctaaagctgatgcgaaa
gtggctgaacaagtgatcatccagtacggcggttccgttaacgcgggcaacgcagcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagccgcgaaaaaagcgtaa

DBGET integrated database retrieval system