KEGG   Klebsiella oxytoca KCTC 1686: KOX_06045Help
Entry
KOX_06045         CDS       T01681                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_06045 (tpiA)
   01230 Biosynthesis of amino acids
    KOX_06045 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_06045 (tpiA)
   00051 Fructose and mannose metabolism
    KOX_06045 (tpiA)
   00562 Inositol phosphate metabolism
    KOX_06045 (tpiA)
Enzymes [BR:kox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KOX_06045 (tpiA)
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KOX_06045 (tpiA)
  Exosomal proteins of bladder cancer cells
   KOX_06045 (tpiA)
  Exosomal proteins of melanoma cells
   KOX_06045 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1259094..1259861
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVTGCAVAIAPPEMYIDLAKQAAAGSHIH
LGAQNVDLNLSGAFTGETSAEMLKDIGAEYIIIGHSERRTYHKESDEFIARKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtcgcgaacctgcgtaccgaactggctggcgtaaccggctgtgcagttgccatt
gctccgcctgagatgtacatcgacctggctaaacaagccgctgcgggcagccacattcac
ctgggcgcgcagaacgttgacctgaacctgtccggcgcgttcactggcgaaacctctgcc
gaaatgctgaaagacatcggcgctgaatacatcatcatcggccactccgagcgccgtacc
taccacaaagagtccgacgagtttatcgccaggaaattcgcggtactgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacggaa
gaagtgtgcgcgcgtcagatcgacgccgttctgaaaacccagggcgcggcggcgttcgaa
ggcgcagttatcgcttatgagcccgtatgggcgatcggtaccggcaaatccgctaccccg
gctcaggctcaggctgtacacaaattcattcgcgaccacatcgctaaagctgatgcgaaa
gtggctgaacaagtgatcatccagtacggcggttccgttaacgcgggcaacgcagcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagccgcgaaaaaagcgtaa

DBGET integrated database retrieval system