KEGG   Klebsiella oxytoca KCTC 1686: KOX_06075Help
Entry
KOX_06075         CDS       T01681                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KOX_06075
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KOX_06075
Exosome [BR:kox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KOX_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264989..1266500
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQSST
LVEVLAKADISSDEIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTAEICEQLKRDG
MEEYIRKATGLVVDPYFSGTKVKWILDHVEGARERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHELDWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVTSTHGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHDEA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaaaaaatatatcgtagcgctcgaccagggcaccaccagctcccgcgccgtg
gtaatggatcacgatgccaatatcgtcagcgtttctcagcgagaattcgaacaaatttat
ccgcgtccaggctgggttgaacacgacccgatggagatctgggcatcgcaaagctctacg
ctggtcgaagtgctggcaaaagccgatatcagctccgatgaaatcgcggcgatcggcatc
accaaccagcgtgaaaccgccatcgtgtgggagcgcgaaaccgggaagccgatttataac
gccatcgtctggcagtgccgccgtaccgccgagatctgcgaacagctcaagcgcgacggc
atggaagagtacatccgcaaggccaccggcctggtggttgacccgtacttctccggcacc
aaagtgaagtggatccttgaccacgtcgaaggcgcgcgcgaacgcgctaaacgcggcgaa
ctgctgttcggcaccgtagacacctggcttatctggaaaatgacccagggacgcgttcac
gtgaccgactacaccaacgcctcgcgtaccatgctgtttaatatccacgagctggactgg
gacgacaaaatgctcgatgcgctggatatcccgcgcgccatgctgccggaagtgcgcaaa
tcttccgaagtgtacggccagaccaacatcggcggtaagggtgggacgcgtattccgatc
gccggcatcgcgggcgaccagcaggcggcgctgttcggccagctgtgcgtgaaagagggg
atggcgaaaaacacctacggtaccggctgctttatgctgatgaataccggcgagaaagcg
gtgacgtcaacgcacggcctgctgacgactatcgcctgcggcccgcgcggtgaggtgaac
tatgcgctggaaggcgcggtgtttatggcgggcgcctctattcagtggctgcgcgatgag
atgaagctgattagcgacgcgttcgattccgaatatttcgccaccaaagtgaaggatacc
aacggcgtgtacgtggttccggcttttaccggactcggcgccccgtactgggacccgtat
gcccgcggcgcgatcttcggcctgacccgcggcgtgaactccaaccatattattcgcgcc
accctggagtcgattgcctatcagacccgcgacgtgctggaagcgatgcaggctgactcc
gggatccgtctccacgccctgcgcgttgacggcggcgcggtcgccaacaacttcctgatg
cagttccagtccgatattctcggcacccgcgtggaacgcccggaagtccgcgaagtcacc
gcgctgggcgcagcctatctggccggtctggcggtcggtttctggcaaaacctggatgaa
ctgcaagagaaagcggtcatcgaacgcgagttccgtccggggattgaaaccaccgagcgt
aactatcgctacagcggctggaagaaagcggtaaaacgcgcgctggcgtgggaagagcac
gacgaagcgtaa

DBGET integrated database retrieval system