KEGG   Klebsiella oxytoca KCTC 1686: KOX_06810Help
Entry
KOX_06810         CDS       T01681                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KOX_06810
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KOX_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1420647..1421576
Genome map
AA seq 309 aa AA seqDB search
MKTAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGERVRRQLESDNIDVAPVRAVAGESTGVALIFVNAEGENTIGIHAGANAAL
SVAQVDAEKERIAGAQALLMQLESPLESVLAAAKIAHQNQTSVILNPAPARELPDELLTL
VDIITPNETEAEKLTGVRVESDDDAAKAAKVLHDKGIGTVIITLGSRGVWASSEGEGRRV
PGFKVQVVDTIAAGDTFNGALVTALLEGSELAQAIRFAHAAAAIAVTRKGAQPSVPWRKE
IDEFLRQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggcaaacttgtcgtccttggcagtatcaacgccgatcacatcctgaat
cttgacgccttcccaacgccgggtgaaaccgttaccggtcatcactatcaggtcgctttt
ggcggtaagggcgcaaaccaggcggttgctgccggacgcagcggagctaatatcgccttt
atcgcctgtaccggcgatgacgatattggcgaacgcgttcgtcgtcagctggaaagcgat
aatatcgacgtcgcgccggtcagggccgttgccggagaatcaaccggcgtggcgctgatt
tttgttaacgctgaaggtgagaatactatcggtattcatgctggcgctaacgccgcgctc
agcgtggctcaggttgatgcggaaaaagagcgtattgccggcgcgcaggcgctgctgatg
cagctggaatcgccgctggaaagcgtactggccgcggcgaaaatcgctcaccagaatcaa
acctcagttatcctcaatccggcgccggcacgtgaactgcccgatgaactgctcacactg
gtggatatcattacccctaacgagaccgaagcggaaaagctcaccggcgttcgcgtagaa
agcgacgatgatgcggcaaaagccgccaaagtgctccatgataaaggtattggtacggtg
atcattacgcttggcagccgtggcgtatgggccagcagcgaaggtgaaggtcgtcgggtt
cccggttttaaagtgcaggtggttgataccatcgccgctggcgatacctttaatggtgcg
ctggtcaccgcgctgcttgaaggtagcgaactggcgcaggcgattcgttttgcccatgcc
gccgccgctatcgccgtcacccgcaaaggggctcagccctccgtgccctggcgaaaagaa
atagacgaatttttacgtcaacaggggtaa

DBGET integrated database retrieval system