KEGG   Klebsiella michiganensis KCTC 1686: KOX_07150Help
Entry
KOX_07150         CDS       T01681                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00052  Galactose metabolism
kox00500  Starch and sucrose metabolism
kox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KOX_07150
   00500 Starch and sucrose metabolism
    KOX_07150
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KOX_07150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C EMP24_GP25L Amb_V_allergen
Motif
Other DBs
NCBI-ProteinID: AEX03160
UniProt: A0A0H3HA14
Position
1496163..1497851
Genome map
AA seq 562 aa AA seqDB search
MSLSFNIKQGQRIDLWLKASEPAAQPLFSIRVNGQVVFKIQEAPRYFQYFTWTSFQDGVA
TLEWLPEYSEISLCYTWHPDSLRARGVTFIATAGQDLRLMSGQDIADEYLREPLRPALHF
SPRTGWMNDPNGLHYKNGEWHLFYQYHPHSSQWGPMHWNHAVSRDLYHWRHYPVFLQPEQ
NLSALGATGGAFSGSAYIDKQGKTRFWYTERLPAYDLYRGYREVQKMAVAHDDYDKPEWV
KTVLTDLPAGVDCDFRDPKVWYEEADATFYMILGASVNGDPAMLLFHSADSERWTFHHVL
YVAPGYFRENGGRCVECPDFFCLDGVWVLIIGVVGYKEPTTGRHNLLFAQTGTFRNGYFT
PSEQPLQTLDFGTDFYALQTWGEDDRRIGFAWLYNWATQKPVDSAYSGEMSLPRRFHLNA
QQRLCMMPELPPESLVVSRHALDDGDIWVNEKGCKAGIVTFMPAGGFRLTLTGDSGQQII
LEQEGKNLTLYEKGRDDGRYRAPVASVSDVTLCFDAGIVEVFANQGSVCGTRRYYSCSQL
TRIQLSGAPAQLTQYRSTYSQE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtcatttaatattaaacaaggtcagcgcattgatttgtggctgaaagcgtcc
gaaccggcggcgcaacccctgttttctattcgcgtgaacggtcaggttgtatttaagatt
caggaggcgccgcgctacttccagtattttacctggacctcgtttcaggacggcgttgcc
accctggagtggctgccggaatatagcgagatatcgctttgttacacctggcatccggat
tcactgcgcgcgcgcggcgtcacctttatcgcgacagccgggcaggatttgcgcctgatg
agcggtcaggatattgctgacgagtatctgcgggagccgctgcgcccggcattgcatttc
tcgccgcgtaccggctggatgaacgaccctaacgggctgcactacaagaacggcgagtgg
catctgttttaccagtatcatccgcactccagccaatggggccccatgcactggaatcat
gctgtgagccgcgatctgtatcactggcggcattatccggttttcctccagccggagcag
aatctttccgcgctgggcgcgacgggcggcgcgttttccggcagcgcgtatattgataaa
caaggaaaaacccgcttctggtataccgaacggctcccggcttacgatctgtatcgcggc
taccgggaagtgcagaaaatggccgttgcgcacgacgactacgataagccggaatgggtg
aaaaccgtcttaaccgacctgcctgcgggcgtggactgcgatttccgcgatccaaaagtg
tggtacgaagaggccgatgccaccttttatatgatcctcggcgcctcggtaaacggcgat
ccggcgatgctgctctttcactctgcggatagtgaacgctggacgttccatcatgtgctg
tatgtcgctcccggctattttcgcgaaaacggcggtcgctgcgtcgaatgcccggatttc
ttctgcctggatggcgtatgggtattaattatcggcgtcgttggctacaaggagccgaca
accgggcggcataatttgctttttgcccagaccggtactttccggaacggttatttcacg
ccgtccgagcagccgctacagactttagatttcggtacggatttctacgccctgcaaacc
tggggcgaggacgaccgaagaatcggctttgcctggttatataactgggcgacgcagaaa
ccggtggattccgcttactcgggggaaatgtcgctcccgcgtcgctttcatctcaatgcg
cagcagcggctatgcatgatgccggagctgccgccggaatcattggtcgtcagccgccat
gcgctggatgacggtgatatctgggttaatgagaaaggctgtaaagccggcattgtaacc
tttatgcctgccggtggtttccgtttgacgttaacgggcgatagcggccagcaaatcatc
ctcgaacaggagggtaaaaatctgacgctatatgaaaaaggccgggacgatgggcgttac
cgcgcgccggtagccagcgtcagcgacgtcacgctgtgttttgatgccgggattgttgag
gtcttcgcaaatcagggcagcgtatgcggtacgcgacgctattactcatgcagtcagctc
acccggatccagctctccggcgcgccggcacagcttacgcaatatcgctcgacgtattcg
caggaataa

DBGET integrated database retrieval system