KEGG   Klebsiella oxytoca KCTC 1686: KOX_07260Help
Entry
KOX_07260         CDS       T01681                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:kox01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kox01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kox00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:kox00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kox00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kox00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:kox00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519679..1520641
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMRKRGLDALVVIGGDGSYMGAVRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAISGGCEFIMVPEVEYTRDDLVSEIKAGIAKGKKHAIVAITEHMCDVDELAHYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLQGFGGRCVGIQNEKLVHHDIIDA
IENMKRPFKSDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgccccgggcatgaacgcagca
attcgtggcgttgtgcgtgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggcctgtatgaagatcgtatggttcagctcgaccgctacagcgtttccgac
atgatcaaccgcggcggcaccttcctggggtcggcgcgttttccagaattccgcgaagaa
catattcgcgccgtcgcgattgaaaatatgagaaagcgcggcctggatgcgctggtggtt
atcggtggtgacggttcctatatgggcgccgtgcgtctgactgagatgggcttcccttgc
atcggtctgccgggcaccatcgacaacgatattaaaggcaccgactataccattggcttc
tttaccgcattgagcaccgtggtagaggccattgaccgcctgcgtgacacctcttcctcc
caccagcgtatttccgttgttgaagtaatgggccgctactgcggcgatctgaccctggcg
gcagctatctccggcggctgtgagttcatcatggtgcctgaggttgaatacacgcgcgac
gacctggtttcagaaattaaggcgggtatcgcgaaaggcaaaaaacacgcgattgtggcg
atcaccgagcatatgtgcgacgtcgacgagctggctcactacatcgagaaagagaccggc
cgtgaaacgcgtgccaccgtactgggccacattcagcgcggcggctctccggttccttat
gaccgtattctggcatcccgcatgggcgcgtacgcgattgacctgctgctgcagggcttc
ggcggccgctgcgttggtattcagaacgagaagctggttcaccacgacattatcgacgct
atcgaaaacatgaagcgtccgttcaaaagcgactggctggattgcgctaagaagctgtac
taa

DBGET integrated database retrieval system