KEGG   Klebsiella oxytoca KCTC 1686: KOX_07260Help
Entry
KOX_07260         CDS       T01681                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_07260
   01230 Biosynthesis of amino acids
    KOX_07260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KOX_07260
   00030 Pentose phosphate pathway
    KOX_07260
   00051 Fructose and mannose metabolism
    KOX_07260
   00052 Galactose metabolism
    KOX_07260
  Energy metabolism
   00680 Methane metabolism
    KOX_07260
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KOX_07260
Protein phosphatases and associated proteins [BR:kox01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KOX_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519679..1520641
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMRKRGLDALVVIGGDGSYMGAVRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAISGGCEFIMVPEVEYTRDDLVSEIKAGIAKGKKHAIVAITEHMCDVDELAHYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLQGFGGRCVGIQNEKLVHHDIIDA
IENMKRPFKSDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgccccgggcatgaacgcagca
attcgtggcgttgtgcgtgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggcctgtatgaagatcgtatggttcagctcgaccgctacagcgtttccgac
atgatcaaccgcggcggcaccttcctggggtcggcgcgttttccagaattccgcgaagaa
catattcgcgccgtcgcgattgaaaatatgagaaagcgcggcctggatgcgctggtggtt
atcggtggtgacggttcctatatgggcgccgtgcgtctgactgagatgggcttcccttgc
atcggtctgccgggcaccatcgacaacgatattaaaggcaccgactataccattggcttc
tttaccgcattgagcaccgtggtagaggccattgaccgcctgcgtgacacctcttcctcc
caccagcgtatttccgttgttgaagtaatgggccgctactgcggcgatctgaccctggcg
gcagctatctccggcggctgtgagttcatcatggtgcctgaggttgaatacacgcgcgac
gacctggtttcagaaattaaggcgggtatcgcgaaaggcaaaaaacacgcgattgtggcg
atcaccgagcatatgtgcgacgtcgacgagctggctcactacatcgagaaagagaccggc
cgtgaaacgcgtgccaccgtactgggccacattcagcgcggcggctctccggttccttat
gaccgtattctggcatcccgcatgggcgcgtacgcgattgacctgctgctgcagggcttc
ggcggccgctgcgttggtattcagaacgagaagctggttcaccacgacattatcgacgct
atcgaaaacatgaagcgtccgttcaaaagcgactggctggattgcgctaagaagctgtac
taa

DBGET integrated database retrieval system