KEGG   Klebsiella michiganensis KCTC 1686: KOX_07620Help
Entry
KOX_07620         CDS       T01681                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00860  Porphyrin and chlorophyll metabolism
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
Module
kox_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KOX_07620 (hemD)
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KOX_07620 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AEX03252
UniProt: A0A0H3H6G6
Position
complement(1605581..1606321)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEELVSRLRALGRVAWSFPLIEFTPGRQLPELGGQLASLAAGDLLFALS
QHAVEFAHARLQQQGLRWPTAPDYFAIGRTTALALHKVSNRQVRYPLDREISEVLLQLPE
LQNIAGKKALILRGNGGRELLGDTLRERGADVTFCECYQRSARHYDGAEEAMRWQSRGVS
TLVITSGEMLQQLWTLIPQWYRERWLLSCRIFVVSERLAEQARELGWQDIQVADSADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctggttacccgtccgctgccgcaaggcgaagagttagtcagccgcctgcgc
gcgctgggacgcgtggcctggagctttccgctcattgagtttaccccgggccgtcagctc
cctgagctgggcggccagctggcaagcctcgccgcaggcgatttactcttcgcgctatct
cagcatgccgtcgagtttgcccacgctcgcctccagcagcaggggctgcgctggcccacg
gcgcccgactattttgccattggccgcaccaccgcgctggccctgcataaggtcagtaat
cgacaagttcgctacccgttagatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaacattgcggggaaaaaagcgctcatcctgcgcggcaacggcgggcgggaatta
ctcggtgacacgcttcgcgaacgcggcgctgatgtcactttttgtgaatgttatcaacgt
agtgcaaggcactacgatggcgcagaagaagcaatgcgctggcagtctcgcggggtttcg
acgctggtcatcaccagcggcgagatgctgcagcagctctggacgctaataccacagtgg
tatcgcgaacgttggctcctgagctgtcgcattttcgttgtcagtgaacgtctggccgag
caggccagggaattgggctggcaggatatccaggttgccgatagcgccgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system