KEGG   Klebsiella oxytoca KCTC 1686: KOX_07705Help
Entry
KOX_07705         CDS       T01681                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:kox00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:kox00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kox00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:kox00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626133..1627005
Genome map
AA seq 290 aa AA seqDB search
MRISLACLLALVALPAGVLAQDAPVNKQVHDAPVVRGSIIANLLQDHDNPFLLYPYESNY
LLYTWTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGENSLLGASYTQKSWWQ
LSNSKESAPFRETNYEPQLFLGFATDYSFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLY
TRLMAQNGNWLVEVKPWYVIGSTDDNPDITKYMGYYRLKVGYQLGDAILSAQGQYNWNTG
YGGAELGVSYPITKHVRVYTQVYSGYGESLIDYNFNQTRVGVGLMLNDLF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttggcctgcctgctggcgcttgttgcgcttccggccggcgttctggcg
caggacgcgccggtgaataaacaggtccacgacgctccggtcgttcgcgggagcattatc
gccaacctgttacaggaccatgataatccgttcctgctctatccctacgagagcaactat
ctgctctatacgtggaccagcgatctcaataaagaagcgattcgtagctacgactgggcc
gaaaatgcgcgtaaagatgaagtgaagttccagctcagcctggcgtttccgctgtggcga
gggatcctcggcgagaattcgctgctgggcgcttcttatacgcaaaaatcctggtggcag
ctctccaacagcaaagagtccgcgccgtttcgcgaaaccaactatgagccgcagctgttc
ctcgggtttgcgaccgattactcgttcgccggctggacgctgcgcgacgttgagatgggt
tataaccacgactctaacggccgttccgatcccacctcccgcagctggaaccgcctctat
acccggctgatggcgcaaaacggcaactggctggttgaggtgaagccctggtacgtgatt
ggcagcaccgacgataatccggatatcaccaaatatatggggtattaccggctgaaagtg
ggctatcagctgggcgacgccatcctcagcgcccaggggcaatataactggaataccggc
tacggcggcgccgagcttggggtgagctatccgatcaccaaacacgtgcgcgtctatact
caggtctatagcggttatggcgagtcgctcatcgattacaacttcaatcagacccgcgtc
ggcgtagggctgatgctcaacgatctgttttaa

DBGET integrated database retrieval system