KEGG   Klebsiella oxytoca KCTC 1686: KOX_07705Help
Entry
KOX_07705         CDS       T01681                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KOX_07705
   00565 Ether lipid metabolism
    KOX_07705
   00590 Arachidonic acid metabolism
    KOX_07705
   00591 Linoleic acid metabolism
    KOX_07705
   00592 alpha-Linolenic acid metabolism
    KOX_07705
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     KOX_07705
    3.1.1.32  phospholipase A1
     KOX_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626133..1627005
Genome map
AA seq 290 aa AA seqDB search
MRISLACLLALVALPAGVLAQDAPVNKQVHDAPVVRGSIIANLLQDHDNPFLLYPYESNY
LLYTWTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGENSLLGASYTQKSWWQ
LSNSKESAPFRETNYEPQLFLGFATDYSFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLY
TRLMAQNGNWLVEVKPWYVIGSTDDNPDITKYMGYYRLKVGYQLGDAILSAQGQYNWNTG
YGGAELGVSYPITKHVRVYTQVYSGYGESLIDYNFNQTRVGVGLMLNDLF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttggcctgcctgctggcgcttgttgcgcttccggccggcgttctggcg
caggacgcgccggtgaataaacaggtccacgacgctccggtcgttcgcgggagcattatc
gccaacctgttacaggaccatgataatccgttcctgctctatccctacgagagcaactat
ctgctctatacgtggaccagcgatctcaataaagaagcgattcgtagctacgactgggcc
gaaaatgcgcgtaaagatgaagtgaagttccagctcagcctggcgtttccgctgtggcga
gggatcctcggcgagaattcgctgctgggcgcttcttatacgcaaaaatcctggtggcag
ctctccaacagcaaagagtccgcgccgtttcgcgaaaccaactatgagccgcagctgttc
ctcgggtttgcgaccgattactcgttcgccggctggacgctgcgcgacgttgagatgggt
tataaccacgactctaacggccgttccgatcccacctcccgcagctggaaccgcctctat
acccggctgatggcgcaaaacggcaactggctggttgaggtgaagccctggtacgtgatt
ggcagcaccgacgataatccggatatcaccaaatatatggggtattaccggctgaaagtg
ggctatcagctgggcgacgccatcctcagcgcccaggggcaatataactggaataccggc
tacggcggcgccgagcttggggtgagctatccgatcaccaaacacgtgcgcgtctatact
caggtctatagcggttatggcgagtcgctcatcgattacaacttcaatcagacccgcgtc
ggcgtagggctgatgctcaacgatctgttttaa

DBGET integrated database retrieval system