KEGG   Klebsiella oxytoca KCTC 1686: KOX_07730Help
Entry
KOX_07730         CDS       T01681                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:kox00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630665..1631657
Genome map
AA seq 330 aa AA seqDB search
MFLQQKDWETRENAFAAFTMGPLTDFWRQREEAEFTGVDNVPVRFVRFCAKSHDRVVVIC
PGRIESYVKYAELAYDLFRSGFDVMIIDHRGQGRSGRMLSDTHRGHVVNFSDYVDDLAAF
WQQQVAPGRWRKRFILAHSMGGAIATLFLQRYHQHCDAMALCAPMFGIVMRLPDWMVRHI
LDWAEGHQRIREEYALGTGRWRALPFAVNVLTHSRQRYRRNLRFYADEPQLRVGGPTFHW
VREGILAGEEVLAGAEKDVTPTLLLQAEEERVVDNRMHDRYCELRAAGGHPCEGDKPFVI
EGAYHEILFEKDAMRSVALNAIVDFFGRHT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcagcaaaaggactgggaaacacgagaaaacgcgtttgcggcctttaccatg
gggccactgaccgatttctggcgtcagcgggaagaggctgaatttacgggcgtggataac
gttccggtgcgctttgttcgcttctgcgccaaaagtcatgaccgggtcgtggttatttgt
ccgggtcgcattgaaagctacgttaagtacgccgaactggcttacgatcttttccgcagc
ggttttgacgtgatgattatcgatcatcgcggccaggggcgctccggacgcatgctttca
gatacccaccgcgggcacgtcgttaatttcagcgattacgttgacgatctcgccgcgttc
tggcagcagcaggtggcacccggacgctggcggaaacggtttatactggcccactccatg
ggcggcgctattgcgacgctatttttgcagcgctaccaccagcattgcgacgcgatggcg
ctctgtgcgccgatgttcggcatcgttatgcgcctgcctgactggatggtgcgccatatt
ctcgattgggctgagggccatcagcgcattcgtgaagagtatgccctcggtaccggccgc
tggcgggcgctgccctttgcggttaacgtactgacgcacagccgtcaacgctatcgccgc
aacctgcgcttttacgccgatgagccgcagctgcgggtcggcgggccgacgttccactgg
gtgcgcgaggggatcctcgccggcgaagaggtgctggccggtgcggagaaagacgtcacg
ccaacattattgctccaggcggaagaagagcgggtggtcgataaccgtatgcacgatcgc
tactgtgaacttcgcgccgctggcggtcatccctgtgaaggggataagccgtttgtcata
gaaggggcataccatgagatcctttttgaaaaggacgcaatgcgctcggtcgcgctaaac
gctatcgtcgatttttttggtcgacacacttaa

DBGET integrated database retrieval system