KEGG   Klebsiella oxytoca KCTC 1686: KOX_07730Help
Entry
KOX_07730         CDS       T01681                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KOX_07730
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KOX_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630665..1631657
Genome map
AA seq 330 aa AA seqDB search
MFLQQKDWETRENAFAAFTMGPLTDFWRQREEAEFTGVDNVPVRFVRFCAKSHDRVVVIC
PGRIESYVKYAELAYDLFRSGFDVMIIDHRGQGRSGRMLSDTHRGHVVNFSDYVDDLAAF
WQQQVAPGRWRKRFILAHSMGGAIATLFLQRYHQHCDAMALCAPMFGIVMRLPDWMVRHI
LDWAEGHQRIREEYALGTGRWRALPFAVNVLTHSRQRYRRNLRFYADEPQLRVGGPTFHW
VREGILAGEEVLAGAEKDVTPTLLLQAEEERVVDNRMHDRYCELRAAGGHPCEGDKPFVI
EGAYHEILFEKDAMRSVALNAIVDFFGRHT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcagcaaaaggactgggaaacacgagaaaacgcgtttgcggcctttaccatg
gggccactgaccgatttctggcgtcagcgggaagaggctgaatttacgggcgtggataac
gttccggtgcgctttgttcgcttctgcgccaaaagtcatgaccgggtcgtggttatttgt
ccgggtcgcattgaaagctacgttaagtacgccgaactggcttacgatcttttccgcagc
ggttttgacgtgatgattatcgatcatcgcggccaggggcgctccggacgcatgctttca
gatacccaccgcgggcacgtcgttaatttcagcgattacgttgacgatctcgccgcgttc
tggcagcagcaggtggcacccggacgctggcggaaacggtttatactggcccactccatg
ggcggcgctattgcgacgctatttttgcagcgctaccaccagcattgcgacgcgatggcg
ctctgtgcgccgatgttcggcatcgttatgcgcctgcctgactggatggtgcgccatatt
ctcgattgggctgagggccatcagcgcattcgtgaagagtatgccctcggtaccggccgc
tggcgggcgctgccctttgcggttaacgtactgacgcacagccgtcaacgctatcgccgc
aacctgcgcttttacgccgatgagccgcagctgcgggtcggcgggccgacgttccactgg
gtgcgcgaggggatcctcgccggcgaagaggtgctggccggtgcggagaaagacgtcacg
ccaacattattgctccaggcggaagaagagcgggtggtcgataaccgtatgcacgatcgc
tactgtgaacttcgcgccgctggcggtcatccctgtgaaggggataagccgtttgtcata
gaaggggcataccatgagatcctttttgaaaaggacgcaatgcgctcggtcgcgctaaac
gctatcgtcgatttttttggtcgacacacttaa

DBGET integrated database retrieval system