KEGG   Klebsiella michiganensis KCTC 1686: KOX_07835Help
Entry
KOX_07835         CDS       T01681                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
kox00071  Fatty acid degradation
kox00280  Valine, leucine and isoleucine degradation
kox00281  Geraniol degradation
kox00310  Lysine degradation
kox00362  Benzoate degradation
kox00380  Tryptophan metabolism
kox00410  beta-Alanine metabolism
kox00640  Propanoate metabolism
kox00650  Butanoate metabolism
kox00903  Limonene and pinene degradation
kox00930  Caprolactam degradation
kox01040  Biosynthesis of unsaturated fatty acids
kox01100  Metabolic pathways
kox01110  Biosynthesis of secondary metabolites
kox01120  Microbial metabolism in diverse environments
kox01130  Biosynthesis of antibiotics
kox01200  Carbon metabolism
kox01212  Fatty acid metabolism
Module
kox_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KOX_07835 (fadB)
   00650 Butanoate metabolism
    KOX_07835 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KOX_07835 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KOX_07835 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KOX_07835 (fadB)
   00310 Lysine degradation
    KOX_07835 (fadB)
   00380 Tryptophan metabolism
    KOX_07835 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KOX_07835 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KOX_07835 (fadB)
   00281 Geraniol degradation
    KOX_07835 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KOX_07835 (fadB)
   00930 Caprolactam degradation
    KOX_07835 (fadB)
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KOX_07835 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KOX_07835 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KOX_07835 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     KOX_07835 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX03295
UniProt: A0A0H3HAC7
Position
complement(1651377..1653566)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWREDGIAELVFDAPGSVNKLDTATVASLGEALDVLEKQKDLQGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQALK
IGLVDGVVKHEKLIDGAVAILRQAIKGDLDWKAKRQPKLEPLHLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALDLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDIDTPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKMAGVISTIQPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEIVRGEKSSDETIAKMVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLAEVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLRSKARHNEPYYPPVEPA
RAPGDLKKA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggcgggaagacggcattgccgaactg
gtatttgatgcccccggctcggtcaacaagctcgataccgcaaccgtagccagcctcggt
gaagcgctggacgtactcgaaaaacaaaaagatctgcaagggctgctgctacgctccgag
aaagccgcttttattgtcggcgcggatatcaccgaatttctttctctgttcctggttccc
gaagaacagctcagccagtggctgcatttcgctaatagcgtctttaatcgcctggaagat
ttgccggttccgaccatttccgccgtcaacggctatgcgttgggcggcggctgcgaatgc
gtgctggcgaccgattatcgcctggcgacgccggatctgcgcattggtctgccggaaacg
aagctgggcatcatgccgggctttggcggctcggtgcggatgccgcggatgcttggcgcg
gacagcgcgctggaaatcattgccgccggcaaagacgttggcgccgaacaggccttaaaa
atcggcctcgtcgatggcgtggttaagcatgaaaaactgatcgatggcgcggtcgcgatt
ctgcgtcaggctattaaaggcgacctggactggaaggcgaagcgccagccgaagctggag
ccgctgcatctgagtaaaattgaagccgcgatgagttttaccatcgccaaaggcatggtg
gcgcaaaccgccgggaagcactacccggccccgattaccgccgttaaaaccatcgaagcc
gccgcccgctttggccgcgaagaagcgctggatctggaaaataaaagtttcgtcccgctg
gcgcataccaacgaggcgcgtgcgctggtaggtatcttccttaacgatcagtacgtcaaa
gcaaaagcgaagaagctgacgaaagatatcgacacgccaaaacacgcggccgtgctgggc
gcggggattatgggcggcggcattgcataccagtcagcctggaaaggcgtgccggtggtc
atgaaagatatcaacgacaaatcgctgacgctgggcatgaccgaagcggccaagctgctg
aataaacagcttgagcgcggcaaaatcgacggtctcaagatggctggcgtcatttctact
attcagccaaccctggattacgccggctttgaacgcgtggacgtcgtggtcgaagccgtt
gttgagaatccgaaagtgaaaaaagcggtgctggcggaaacggaagacaaagtccgcccg
gataccgtgctggcttcgaatacctccaccattcccatcagcgagttggccagcgtactg
aagcgcccggaaaacttctgtggtatgcacttctttaacccggtgcaccggatgccgctg
gtcgagatcgttcgcggcgaaaaaagctcggacgaaaccattgcgaaaatggtcgcctgg
gccagcaaaatgggcaaaacgccgattgtggtcaacgactgccccggtttctttgttaac
cgcgtgctgttcccctacttcgccggtttcagccagctgctgcgcgacggcgcggacttc
cgcaaagtcgataaagtgatggagaagcagtttggctggccgatgggcccggcctatctg
ctggacgtcgttggcattgataccgcgcatcacgcgcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgatgcgatcgatgcgctgttcgacgctaaccgt
ttcggccagaaaaatggcctcggcttctggcgctacaaagaagacagtaaaggtaaaccg
aagaaggaagaggatgccgcagtcgatagcctgctggcggaagttagccagccgaagcgt
gatttcagcgatgaagagattatcgcccggatgatgatccccatggttaatgaagtggtg
cgctgtctcgaagagggcattatcgccagcccggcagaagccgatatggcgctggtttat
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggatacgctcggtagc
gcaaaatatctcgatatggcccagcagtatcagcatctcggcccgctatacgacgtgccg
gaaggattgcgcagcaaagcgcgtcataacgaaccgtactatccaccagttgagcctgcc
cgtgcgccaggcgacctgaaaaaggcttaa

DBGET integrated database retrieval system