KEGG   Klebsiella oxytoca KCTC 1686: KOX_07835Help
Entry
KOX_07835         CDS       T01681                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:kox01200]
Metabolism; Overview; Fatty acid metabolism [PATH:kox01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:kox00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:kox00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:kox00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:kox01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:kox00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:kox00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:kox00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:kox00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:kox00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:kox00281]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:kox00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1651377..1653566)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWREDGIAELVFDAPGSVNKLDTATVASLGEALDVLEKQKDLQGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQALK
IGLVDGVVKHEKLIDGAVAILRQAIKGDLDWKAKRQPKLEPLHLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALDLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDIDTPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKMAGVISTIQPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEIVRGEKSSDETIAKMVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDSLLAEVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLRSKARHNEPYYPPVEPA
RAPGDLKKA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggcgggaagacggcattgccgaactg
gtatttgatgcccccggctcggtcaacaagctcgataccgcaaccgtagccagcctcggt
gaagcgctggacgtactcgaaaaacaaaaagatctgcaagggctgctgctacgctccgag
aaagccgcttttattgtcggcgcggatatcaccgaatttctttctctgttcctggttccc
gaagaacagctcagccagtggctgcatttcgctaatagcgtctttaatcgcctggaagat
ttgccggttccgaccatttccgccgtcaacggctatgcgttgggcggcggctgcgaatgc
gtgctggcgaccgattatcgcctggcgacgccggatctgcgcattggtctgccggaaacg
aagctgggcatcatgccgggctttggcggctcggtgcggatgccgcggatgcttggcgcg
gacagcgcgctggaaatcattgccgccggcaaagacgttggcgccgaacaggccttaaaa
atcggcctcgtcgatggcgtggttaagcatgaaaaactgatcgatggcgcggtcgcgatt
ctgcgtcaggctattaaaggcgacctggactggaaggcgaagcgccagccgaagctggag
ccgctgcatctgagtaaaattgaagccgcgatgagttttaccatcgccaaaggcatggtg
gcgcaaaccgccgggaagcactacccggccccgattaccgccgttaaaaccatcgaagcc
gccgcccgctttggccgcgaagaagcgctggatctggaaaataaaagtttcgtcccgctg
gcgcataccaacgaggcgcgtgcgctggtaggtatcttccttaacgatcagtacgtcaaa
gcaaaagcgaagaagctgacgaaagatatcgacacgccaaaacacgcggccgtgctgggc
gcggggattatgggcggcggcattgcataccagtcagcctggaaaggcgtgccggtggtc
atgaaagatatcaacgacaaatcgctgacgctgggcatgaccgaagcggccaagctgctg
aataaacagcttgagcgcggcaaaatcgacggtctcaagatggctggcgtcatttctact
attcagccaaccctggattacgccggctttgaacgcgtggacgtcgtggtcgaagccgtt
gttgagaatccgaaagtgaaaaaagcggtgctggcggaaacggaagacaaagtccgcccg
gataccgtgctggcttcgaatacctccaccattcccatcagcgagttggccagcgtactg
aagcgcccggaaaacttctgtggtatgcacttctttaacccggtgcaccggatgccgctg
gtcgagatcgttcgcggcgaaaaaagctcggacgaaaccattgcgaaaatggtcgcctgg
gccagcaaaatgggcaaaacgccgattgtggtcaacgactgccccggtttctttgttaac
cgcgtgctgttcccctacttcgccggtttcagccagctgctgcgcgacggcgcggacttc
cgcaaagtcgataaagtgatggagaagcagtttggctggccgatgggcccggcctatctg
ctggacgtcgttggcattgataccgcgcatcacgcgcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgatgcgatcgatgcgctgttcgacgctaaccgt
ttcggccagaaaaatggcctcggcttctggcgctacaaagaagacagtaaaggtaaaccg
aagaaggaagaggatgccgcagtcgatagcctgctggcggaagttagccagccgaagcgt
gatttcagcgatgaagagattatcgcccggatgatgatccccatggttaatgaagtggtg
cgctgtctcgaagagggcattatcgccagcccggcagaagccgatatggcgctggtttat
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggatacgctcggtagc
gcaaaatatctcgatatggcccagcagtatcagcatctcggcccgctatacgacgtgccg
gaaggattgcgcagcaaagcgcgtcataacgaaccgtactatccaccagttgagcctgcc
cgtgcgccaggcgacctgaaaaaggcttaa

DBGET integrated database retrieval system