KEGG   Klebsiella oxytoca KCTC 1686: KOX_08040Help
Entry
KOX_08040         CDS       T01681                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_08040
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KOX_08040
   00630 Glyoxylate and dicarboxylate metabolism
    KOX_08040
Enzymes [BR:kox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KOX_08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710132..1711733
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGDQEKQILTPEAVEFLTELVRRFTPERNKLLAARIQQQQAIDN
GKLPDFISETDSIRSGDWKIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPALLICRVRGLHLPEKHVTWR
REAIPGSLFDFALYFFHNYKALLEKGSGPYFYLPKTQAWQEAAWWSEVFSFTEDRFELPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNGVLGENKNQLSVTREDDAPITAEQLLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGTPVTKALFR
QWLAEEMRVIQDELGEHRYSSGRFDEAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcactgacgaactggcttttagccagccatatggcgaccag
gagaagcaaatcttaacgcctgaggccgtagaatttctgaccgagctggtgcgccgcttt
acgcctgagcgcaataaactcctggccgcgcgtatccagcagcagcaggcaattgataac
ggcaagcttcccgattttatttcggaaacggattccattcgtagcggtgattggaagatc
cgcggcattccggacgatttgcaggatcggcgggtagaaattaccggtccggtagagcgc
aagatggtcatcaatgcgctcaatgcgaatgtaaaagtctttatggcggatttcgaagac
tcactggcgcccgaatggagcaaagtcattgatgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctacaccaatgaagccggcaagatttatcagctgaagccgaacccg
gcgctgctgatctgccgcgtgcgcggtctgcatctgccggaaaaacacgtgacgtggcgc
agggaagcgattcccggcagtctgttcgacttcgccctctatttcttccacaactacaaa
gcgttactggaaaaaggcagcggcccctatttctatctgccgaagactcaggcctggcag
gaagccgcgtggtggagtgaagtatttagctttacggaagaccgttttgagctgccgcgc
ggcaccatcaaagccacgctgctgatcgaaacgctgcccgccgtattccagatggacgaa
attctgcacgccctgcgcgaccatattgtgggtctgaactgcgggcgctgggactacatc
ttcagctatatcaaaacgctgaagaatcatccggatcgcgttctgccggaccgtcaggtg
gtgacgatggacaagcctttcctcagcgcctactcgcgattgttgattaagacctgccac
aggcgcggcgcgtttgcgatgggcggcatggcggcctttattccgagcaaagatgccgag
cgaaacaaccaggtgctgaacaaggtaaaagcggacaaatcgctggaggcgaataacggt
catgacggtacctggatcgcgcatcccgggctggctgacaccgcgatggccgtctttaac
ggcgtactgggcgagaacaaaaatcagctgtccgttacccgcgaagacgatgcgccgatt
accgctgaacagctgttggctccctgcgagggcgaacgaaccgaagagggcatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaggcgtggatttccggcaacggctgcgtaccg
atttatggcctgatggaagatgcggcgacggcggaaatctcccgtacctctatctggcaa
tggatccaccatgagaaaaccctcagtaacggcacaccggtcaccaaagcgctgttccgc
cagtggctggccgaagagatgcgggtgattcaggacgaactgggcgagcaccgctacagc
agcgggcgttttgatgaagccgctcgcctgatggaacagatcaccacctccgacgagctg
attgatttcttaaccctgccgggctaccgccttctggcctaa

DBGET integrated database retrieval system