KEGG   Klebsiella oxytoca KCTC 1686: KOX_08040Help
Entry
KOX_08040         CDS       T01681                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_08040
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KOX_08040
   00630 Glyoxylate and dicarboxylate metabolism
    KOX_08040
Enzymes [BR:kox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KOX_08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1710132..1711733
Genome map
AA seq 533 aa AA seqDB search
MTQQATITDELAFSQPYGDQEKQILTPEAVEFLTELVRRFTPERNKLLAARIQQQQAIDN
GKLPDFISETDSIRSGDWKIRGIPDDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPALLICRVRGLHLPEKHVTWR
REAIPGSLFDFALYFFHNYKALLEKGSGPYFYLPKTQAWQEAAWWSEVFSFTEDRFELPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNGVLGENKNQLSVTREDDAPITAEQLLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGTPVTKALFR
QWLAEEMRVIQDELGEHRYSSGRFDEAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggcgacaatcactgacgaactggcttttagccagccatatggcgaccag
gagaagcaaatcttaacgcctgaggccgtagaatttctgaccgagctggtgcgccgcttt
acgcctgagcgcaataaactcctggccgcgcgtatccagcagcagcaggcaattgataac
ggcaagcttcccgattttatttcggaaacggattccattcgtagcggtgattggaagatc
cgcggcattccggacgatttgcaggatcggcgggtagaaattaccggtccggtagagcgc
aagatggtcatcaatgcgctcaatgcgaatgtaaaagtctttatggcggatttcgaagac
tcactggcgcccgaatggagcaaagtcattgatgggcaaattaacctgcgcgatgcggtt
aacggcaccatcagctacaccaatgaagccggcaagatttatcagctgaagccgaacccg
gcgctgctgatctgccgcgtgcgcggtctgcatctgccggaaaaacacgtgacgtggcgc
agggaagcgattcccggcagtctgttcgacttcgccctctatttcttccacaactacaaa
gcgttactggaaaaaggcagcggcccctatttctatctgccgaagactcaggcctggcag
gaagccgcgtggtggagtgaagtatttagctttacggaagaccgttttgagctgccgcgc
ggcaccatcaaagccacgctgctgatcgaaacgctgcccgccgtattccagatggacgaa
attctgcacgccctgcgcgaccatattgtgggtctgaactgcgggcgctgggactacatc
ttcagctatatcaaaacgctgaagaatcatccggatcgcgttctgccggaccgtcaggtg
gtgacgatggacaagcctttcctcagcgcctactcgcgattgttgattaagacctgccac
aggcgcggcgcgtttgcgatgggcggcatggcggcctttattccgagcaaagatgccgag
cgaaacaaccaggtgctgaacaaggtaaaagcggacaaatcgctggaggcgaataacggt
catgacggtacctggatcgcgcatcccgggctggctgacaccgcgatggccgtctttaac
ggcgtactgggcgagaacaaaaatcagctgtccgttacccgcgaagacgatgcgccgatt
accgctgaacagctgttggctccctgcgagggcgaacgaaccgaagagggcatgcgcgcc
aacattcgcgtggcggtgcagtacatcgaggcgtggatttccggcaacggctgcgtaccg
atttatggcctgatggaagatgcggcgacggcggaaatctcccgtacctctatctggcaa
tggatccaccatgagaaaaccctcagtaacggcacaccggtcaccaaagcgctgttccgc
cagtggctggccgaagagatgcgggtgattcaggacgaactgggcgagcaccgctacagc
agcgggcgttttgatgaagccgctcgcctgatggaacagatcaccacctccgacgagctg
attgatttcttaaccctgccgggctaccgccttctggcctaa

DBGET integrated database retrieval system