KEGG   Klebsiella oxytoca KCTC 1686: KOX_08045Help
Entry
KOX_08045         CDS       T01681                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_08045
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KOX_08045
Enzymes [BR:kox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KOX_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1711765..1713069
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELNKEWTNPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNSFRRADQIQWSAGIEPNDPRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDRQFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELAKR
FADAIHAKYPGKLLAYNCSPSFNWQKKLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEEDQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaattaaacaaagagtggacgaatccgcgctgg
gaaggcattactcgcccatacagcgccgaagatgtggtgaagctgcgcggctcggtcaac
ccggaatgtactctggcgcagctgggcgcggcaaagatgtggcgactgctgcacggggaa
gcgaaaaaaggctacgtcaacagcttgggcgcgctgaccggcggtcaggcgctgcagcag
gcgaaagcgggcattgaagcgatttatctttccggctggcaggtcgcagcggacgccaac
ctggcctccagcatgtatccggatcaatcgctctatccggcgaactcggtaccggccgtg
gtcgatcggatcaacaacagcttccgccgcgcggatcagatccagtggtctgcgggcatt
gagccgaacgatccgcgttataccgattatttcctgccgatcgtcgccgatgcggaagcg
gggtttggcggcgtgcttaatgcgtttgagctgatgaaatcgatgattgaggccggtgca
gcggccgtacacttcgaagaccagctggcatcggtgaaaaaatgcggccatatgggcggc
aaagtgctggttcccacgcaagaggcgattcagaaactggtcgccgcgcgtctggcggcg
gacgtcatgggcgtgccgacgctggtgatcgctcgcactgacgccgatgcggcggattta
attacctcagactgcgatccttacgatcgccagttcattaccggcgaccgtaccagcgaa
ggtttcttccgtacccatgccggtatcgaacaggccatcagccgcgggctggcctacgcg
ccctatgccgacctggtgtggtgtgagacctctaccccggaccttgagctggcgaagcgc
tttgccgacgcgatccacgcgaaatatccgggcaaactgctggcctacaactgctcgccg
tcgtttaactggcagaaaaagctggatgataaaaccattgccagcttccagcagcagctg
tcggatatgggctacaagtatcagttcatcaccctggccggtattcacagcatgtggttc
aacatgttcgacctggcccacgcctacgcccagggcgaggggatgaagcactacgttgag
aaggtccagcagccggagttcgcggcggctaaagatggctacacctttgtctctcatcag
caggaggtcggcaccggatacttcgataaggtcaccaccattatccagggcggagcctca
tcagtcacggcgttaaccggctctacagaagaagatcagttctga

DBGET integrated database retrieval system