KEGG   Klebsiella oxytoca KCTC 1686: KOX_08045Help
Entry
KOX_08045         CDS       T01681                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KOX_08045
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KOX_08045
Enzymes [BR:kox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KOX_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1711765..1713069
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELNKEWTNPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNSFRRADQIQWSAGIEPNDPRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDRQFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELAKR
FADAIHAKYPGKLLAYNCSPSFNWQKKLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEEDQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaattaaacaaagagtggacgaatccgcgctgg
gaaggcattactcgcccatacagcgccgaagatgtggtgaagctgcgcggctcggtcaac
ccggaatgtactctggcgcagctgggcgcggcaaagatgtggcgactgctgcacggggaa
gcgaaaaaaggctacgtcaacagcttgggcgcgctgaccggcggtcaggcgctgcagcag
gcgaaagcgggcattgaagcgatttatctttccggctggcaggtcgcagcggacgccaac
ctggcctccagcatgtatccggatcaatcgctctatccggcgaactcggtaccggccgtg
gtcgatcggatcaacaacagcttccgccgcgcggatcagatccagtggtctgcgggcatt
gagccgaacgatccgcgttataccgattatttcctgccgatcgtcgccgatgcggaagcg
gggtttggcggcgtgcttaatgcgtttgagctgatgaaatcgatgattgaggccggtgca
gcggccgtacacttcgaagaccagctggcatcggtgaaaaaatgcggccatatgggcggc
aaagtgctggttcccacgcaagaggcgattcagaaactggtcgccgcgcgtctggcggcg
gacgtcatgggcgtgccgacgctggtgatcgctcgcactgacgccgatgcggcggattta
attacctcagactgcgatccttacgatcgccagttcattaccggcgaccgtaccagcgaa
ggtttcttccgtacccatgccggtatcgaacaggccatcagccgcgggctggcctacgcg
ccctatgccgacctggtgtggtgtgagacctctaccccggaccttgagctggcgaagcgc
tttgccgacgcgatccacgcgaaatatccgggcaaactgctggcctacaactgctcgccg
tcgtttaactggcagaaaaagctggatgataaaaccattgccagcttccagcagcagctg
tcggatatgggctacaagtatcagttcatcaccctggccggtattcacagcatgtggttc
aacatgttcgacctggcccacgcctacgcccagggcgaggggatgaagcactacgttgag
aaggtccagcagccggagttcgcggcggctaaagatggctacacctttgtctctcatcag
caggaggtcggcaccggatacttcgataaggtcaccaccattatccagggcggagcctca
tcagtcacggcgttaaccggctctacagaagaagatcagttctga

DBGET integrated database retrieval system