KEGG   Klebsiella oxytoca KCTC 1686: KOX_09035Help
Entry
KOX_09035         CDS       T01681                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    KOX_09035
Enzymes [BR:kox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     KOX_09035
Transfer RNA biogenesis [BR:kox03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    KOX_09035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1916847..1917590
Genome map
AA seq 247 aa AA seqDB search
MLEQVCQLARNAGDAIMEVYDGKQPMDVASKKDDSPVTAADIAAHKVIISGLLALTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEKGKPILGVVYAPVM
KVMYSAEKGKAWKEECGVRKQIQVRDARPPLVVISRSHGNDPELQEYLEQLGEHQTTSIG
SSLKFCLVAEGQAQLYPRFGPTSTWDTAAGHAVASAAGAHVHDWQGRTLDYTPRESFLNP
GFRVSIY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgtcagctagcacggaacgcgggcgatgccatcatggaagtttac
gatggaaaacagccgatggacgttgccagcaagaaggacgattctccggtcacggccgcg
gatattgcggcgcacaaggtgattatcagcggcctgctggcgctgacgcccgatattccg
gttctgtcggaagaggacccgccggcctgggaggtgcgccagcactggcagcgctactgg
ctggtggacccgctggacggcaccaaagaatttatcaagcgcaacggcgagtttaccgtc
aatatcgccttgattgaaaaagggaagccgatccttggcgtggtctacgcgccggtgatg
aaggtgatgtacagcgcggaaaagggcaaagcgtggaaagaggagtgcggcgttcgcaag
cagattcaggtccgcgatgcgcgtccgccgctggtggtgattagccgctcccacggcaat
gacccggagctgcaggagtatctggagcagcttggcgaacaccagaccacctcaatcggt
tcgtcgctgaagttctgtctggtcgccgaagggcaggcccagctttatccgcgcttcggg
ccgacctccacctgggacaccgcggccggtcatgcggtcgccagcgccgccggggcgcac
gttcacgactggcaggggcgtacccttgattacacgccgcgtgaatcgttcctcaacccc
ggcttccgggtctctatttattga

DBGET integrated database retrieval system