KEGG   Klebsiella oxytoca KCTC 1686: KOX_09055Help
Entry
KOX_09055         CDS       T01681                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KOX_09055
Enzymes [BR:kox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     KOX_09055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1919637..1921646)
Genome map
AA seq 669 aa AA seqDB search
MSDLFYGVAYYDEYMPEDRLAKDIALMQETGINVVRIAESTWSTLEPREGEYNFYHIDRV
LNAMHKAGIAVIIGTPTYAVPAWLAAKHPDILVTTVNGQQKYGPRQIMDIVNPTFRRYAE
KIIRTLMAHVQHHPAIIGWQLDNETKHYDNIGRHMQEGFVRSLREKYPDLDRLNNDFGLD
YWSNRIDSWQDFPPVENTINASLACAFSRYQRQQVTEYLAWQAEIVREYAQPHQFVTHNF
DFEWRGYSYGVQPRVDHFAAAQTLDIAGVDIYHPSQKHLTGREIAFGGAITRSLKQGKNY
FVLETQAQGFAQWTPYPGQLRLQAFSHVASGAAMVSYWHWHSIHNAFETYWKGLLSHDFS
RNATWQEATTIGADFARLSPQLAELKAENDVALLISNEAMDALNQFRPGDAQGNIYNDIF
RRFHDALYDHNISLDIIHDVNEETARYRALIVPGLYAADDGLLTRINRYIEQGGRALIGF
KSGFSDENVKVRSGAQPGILRESCGVSYSQFTLPEETTVRACSADIDCRQDNQAELWMEL
LTPDAGTRTLLRYQHPAWGDYAAATEADYAQGRAIYVGFLPQKTLISQLFDRLTAGLDLR
SRTSAYRYPLVVKKMRNRDGNSIHFLFNYSGEPQAFISETSGNALLSGEKVSCGQPLRLK
AWEFTIIES
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttattttatggcgtggcctattacgatgaatatatgccggaagatcggctg
gcgaaagatatcgccttaatgcaggaaacgggcattaacgtggtgcggattgccgaatcg
acctggagtacgctggagccccgggagggcgaatataacttctaccatatcgaccgggtg
ctgaatgccatgcataaagcggggatcgcggtgattatcggcacgccaacctacgccgtc
ccggcctggctggcggcgaagcacccggatatcctggtcactaccgtcaacgggcagcaa
aaatatggcccgcgccagattatggatatcgtcaacccgacctttcgccgctatgccgaa
aagattatccgtacgctaatggcgcacgtgcagcaccatccggcgattattggctggcag
ctggataacgaaaccaagcattacgataatatcggccgccatatgcaggagggttttgta
cgcagcctgcgggaaaaataccccgatcttgaccggttgaataacgattttggtctggac
tactggagcaaccgcatcgatagctggcaggattttccgccggtcgaaaacactatcaac
gccagcctcgcctgcgcgttctcccgctaccagcgccagcaggtgacggagtatctcgcc
tggcaggcggagatcgtgcgcgaatatgcccagccgcatcagttcgtcacccacaacttc
gattttgaatggcgcggctactcctacggcgtgcagccgcgagttgaccattttgcggcg
gcgcagacgctggatattgccggtgtcgatatctatcacccgagccagaaacacctgacc
gggcgagaaatcgcgtttggcggcgccattacgcgttcgctaaagcagggtaagaattac
ttcgtgctggaaacccaggcgcagggctttgcccagtggacaccttatccgggccagctg
cgcctgcaggcttttagccacgtggcatcgggggcggcaatggtctcttactggcactgg
cattcgattcataacgcgttcgagacctactggaaggggctgttaagccacgacttctcg
cgcaacgcgacctggcaggaggccaccactatcggggctgactttgcccgcctgtcgccg
cagctggcggagctgaaggcagaaaacgacgtcgcgctgctgataagcaatgaggcgatg
gacgcccttaaccagttccgccccggcgacgcgcagggcaatatttataacgatattttc
cgccgcttccacgatgcgctgtacgaccacaatatcagcctcgatattatccacgacgtt
aacgaggaaaccgcgcgctaccgcgcgctgatcgtacccggactctacgccgccgatgat
ggcctgctgacgcgcatcaaccgctatatcgaacagggcggcagagcgctgatcggcttt
aaatcgggctttagcgatgaaaacgtgaaggtgcgcagcggcgcgcagccgggaattttg
cgcgagagctgcggcgtgagctacagtcaattcaccctgccggaagaaaccacggtacgc
gcctgcagcgcggacattgattgccgtcaagacaatcaggccgagctgtggatggagctg
ctgacgccggacgccggtacccgtacgctactgcgctatcagcatccggcatggggcgac
tatgccgccgccaccgaggcggattacgctcagggtcgggccatttacgttggcttcctg
ccgcagaaaacgctgattagccagctgttcgatcggctgaccgcaggactggatctgcgt
tcacgtacatcggcctaccgctatccgctggtggtcaaaaagatgcgcaaccgcgacggc
aacagcatccacttcctgttcaactactccggcgaaccgcaggcgtttatcagcgagaca
tcgggcaacgcgctgttgagcggggaaaaagttagctgcggccagccgttgcgcctcaaa
gcatgggaatttactatcatcgaaagttaa

DBGET integrated database retrieval system