KEGG   Klebsiella oxytoca KCTC 1686: KOX_10260Help
Entry
KOX_10260         CDS       T01681                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KOX_10260
   00240 Pyrimidine metabolism
    KOX_10260
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KOX_10260
   03430 Mismatch repair
    KOX_10260
   03440 Homologous recombination
    KOX_10260
Enzymes [BR:kox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     KOX_10260
DNA replication proteins [BR:kox03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     KOX_10260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2187541..2187954
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPGHIRLVMVAEEPPSLTEPLISDILRA
LALMPEQVMQLTPERVAMLPQDARCNSWRLGTDAPLLLAGAQLSTPAFDELQTSTPARMA
LWQQICAHEHDFYPQSG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcaattacagcagctgggcatcacccagtggtcgctacgt
cgtcctggggcgttacagggtgaaatcgctatctcgcttcctggacacattcgtctggtg
atggtggcggaagaaccgccatcgctgaccgaaccgcttatcagcgatattctgcgcgcg
ctggccctgatgccggagcaggtgatgcagctgacgcctgaacgcgttgcgatgctgcct
caggacgcacgctgtaatagctggcggctcggcaccgacgcgccgctgctgctggcgggc
gcacagctttccacgcccgcattcgatgaacttcagaccagcacgcctgctcgcatggcg
ctctggcaacagatttgcgcacatgaacacgatttctaccctcaatccggctga

DBGET integrated database retrieval system