KEGG   Klebsiella oxytoca KCTC 1686: KOX_10310Help
Entry
KOX_10310         CDS       T01681                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kox00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2196527..2197849
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDSRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLLEVTMALCVEMLISGKLAQNDADARAKL
QAVLDNGKAAEVFGRMVAAQKGPNDFVENYDKYLPAAMLSKAVYAEGEGFVAEMDTRALG
MAVVSMGGGRRQASDLIDYSVGFTDVVRLGARIDAQQPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEMTPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagcgatgaa
gagattcgttttttcatcaacggcatccgcgacaacaccatctcagaagggcagatcgcc
gcgctggcgatgaccatttttttccacgatatgtctatgccggaacgcgtttcgctgacc
atggcgatgcgggattcagggaccgttctcgactggaagagtcttaacctcaatggcccg
atcgtcgataaacactctaccggcggcgtaggcgatgtgacctcgctgatgctggggccg
atggtcgcggcctgcggcggctatgtcccgatgatctcggggcgcggtctcgggcacacc
ggcggtacgctcgacaagctggaagcgattcctgggttcgatattttcccggacgatagc
cgcttccgtgaaatcattaaagatgtcggcgtcgcgattatcgggcagaccagctctctg
gcaccggcggacaaacgtttttacgccacgcgcgatatcaccgcaacggtggactctatc
ccgctgatcaccgcctccattctcgccaagaagctggcggaaggcctggacgcgctggtg
atggatgtcaaagtcggcagcggcgcctttatgcctacttatgagctttccgccgcgctg
gccgaagcgatcgtcggggtatccaacggcgccggcgtgcggacgaccgcgctgttaacc
gatatgaaccaggtgctggcttccagcgccggtaatgcggtggaagtgcgtgaagccgtg
cagttcctcaccggcgagtaccgcaatccgcggctgcttgaggtgacgatggcgctgtgc
gtcgagatgctgatttccggcaagctggcgcagaatgacgccgacgcgcgggcgaagcta
caggcggtgctggataacggtaaagccgcagaagtcttcggccggatggtggcggcgcaa
aaagggccgaacgacttcgtggaaaactacgataagtatctgccggccgcgatgctgagc
aaagccgtctatgccgaaggcgaagggtttgtcgccgaaatggacacccgcgcgctgggc
atggcggtggtgtcaatgggcggcggtcgccgtcaggcatcggatctgattgattacagc
gtcggtttcaccgacgtggttcgcctcggcgcgcgtatcgacgcgcagcagccgctggcg
gttatccatgctaaagatgaaaacagctggcaggaagcggccaaagccgtgaaagcggcc
attaaacttgacgataaagcgcctgaaatgacgccgacggtctatcgtcgtatcaccgaa
tag

DBGET integrated database retrieval system