KEGG   Klebsiella oxytoca KCTC 1686: KOX_10420Help
Entry
KOX_10420         CDS       T01681                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KOX_10420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_10420
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KOX_10420
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KOX_10420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2222024..2223304
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDEMLQQDFVSRSAKILS
AFIGDEIPQGVLQERIGNAFTFPAPVSKVQDDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLQDGNWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGYAAVDDETTKETMRELKAIGYTSEPHAAIAYRA
LRDQLQAGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataacttaaaagatcataacgaacaggtcagctttgcgcaggccgtcacg
caggggcttggcaagcatcaggggctgttcttcccgcacgatctgccggaattcagcctg
actgaaatcgacgagatgctgcagcaggactttgtgtcgcgtagcgcaaaaatcctgtcg
gcatttatcggcgatgagattccgcagggcgttctgcaagagcgcatcggcaatgccttt
accttcccggctccggtcagcaaagtgcaggacgacgtcggctgcctcgaactgttccac
ggcccgactctggcgtttaaagacttcggcggccgctttatggcgcagatgctcacccat
atcgcaggcgacaaaccggtcactattctgacggccacctccggcgacaccggcgcggcg
gttgcgcacgcgttttatggcctgccaaacgtcaaagtggtcattctctatccgcgcggc
aaaatcagcccgctgcaggaaaagctgttctgcaccctcggcggcaacattgaaactgtg
gcaatcgacggcgactttgacgcctgccaggcgctggttaaacaggcctttgatgatgaa
gagctgaaagctgcgctgggtcttaactcggctaactcaatcaatatcagccgcctgctg
gcgcagatttgctattactttgaagccgtggctcagctgcctcaggaagcccgtaaccag
ctggttatctcggtacccagcggtaactttggcgatctgaccgccggcctgctggccaaa
tctctgggtctgccaatcaaacgctttattgcggcgactaacgctaacgacaccgtgccg
cgcttcctgcaggacggtaactggtcgccgaaagcaacccaggccacgctgtctaacgcc
atggacgtcagccagccgaacaactggccgcgcgtggaagagctgttccgtcgtaaaatc
tggcgcctgaacgagctgggctacgcggcggtggatgatgaaaccaccaaagagaccatg
cgtgagctgaaggctatcggctatacctcagaaccgcatgcggcgattgcttatcgcgcg
ctgcgcgaccagctgcaggcgggcgagtacggcctgttcctcggcacggctcatccggcg
aagtttaaagagagcgtggaagagattctgcaagagacgctgccgctgccgaaagagctg
gccgatcgcgccgatctgccgctgctgtcgcataatctgccggccgattttgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system