KEGG   Klebsiella oxytoca KCTC 1686: KOX_10420Help
Entry
KOX_10420         CDS       T01681                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KOX_10420
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KOX_10420
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KOX_10420
Enzymes [BR:kox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KOX_10420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2222024..2223304
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDEMLQQDFVSRSAKILS
AFIGDEIPQGVLQERIGNAFTFPAPVSKVQDDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKAALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLQDGNWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGYAAVDDETTKETMRELKAIGYTSEPHAAIAYRA
LRDQLQAGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataacttaaaagatcataacgaacaggtcagctttgcgcaggccgtcacg
caggggcttggcaagcatcaggggctgttcttcccgcacgatctgccggaattcagcctg
actgaaatcgacgagatgctgcagcaggactttgtgtcgcgtagcgcaaaaatcctgtcg
gcatttatcggcgatgagattccgcagggcgttctgcaagagcgcatcggcaatgccttt
accttcccggctccggtcagcaaagtgcaggacgacgtcggctgcctcgaactgttccac
ggcccgactctggcgtttaaagacttcggcggccgctttatggcgcagatgctcacccat
atcgcaggcgacaaaccggtcactattctgacggccacctccggcgacaccggcgcggcg
gttgcgcacgcgttttatggcctgccaaacgtcaaagtggtcattctctatccgcgcggc
aaaatcagcccgctgcaggaaaagctgttctgcaccctcggcggcaacattgaaactgtg
gcaatcgacggcgactttgacgcctgccaggcgctggttaaacaggcctttgatgatgaa
gagctgaaagctgcgctgggtcttaactcggctaactcaatcaatatcagccgcctgctg
gcgcagatttgctattactttgaagccgtggctcagctgcctcaggaagcccgtaaccag
ctggttatctcggtacccagcggtaactttggcgatctgaccgccggcctgctggccaaa
tctctgggtctgccaatcaaacgctttattgcggcgactaacgctaacgacaccgtgccg
cgcttcctgcaggacggtaactggtcgccgaaagcaacccaggccacgctgtctaacgcc
atggacgtcagccagccgaacaactggccgcgcgtggaagagctgttccgtcgtaaaatc
tggcgcctgaacgagctgggctacgcggcggtggatgatgaaaccaccaaagagaccatg
cgtgagctgaaggctatcggctatacctcagaaccgcatgcggcgattgcttatcgcgcg
ctgcgcgaccagctgcaggcgggcgagtacggcctgttcctcggcacggctcatccggcg
aagtttaaagagagcgtggaagagattctgcaagagacgctgccgctgccgaaagagctg
gccgatcgcgccgatctgccgctgctgtcgcataatctgccggccgattttgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system