KEGG   Klebsiella oxytoca KCTC 1686: KOX_10900Help
Entry
KOX_10900         CDS       T01681                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    KOX_10900 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KOX_10900 (murE)
Enzymes [BR:kox01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     KOX_10900 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2339445..2340932
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERILREMTLDSRVAASGDLFIAVLGHQADGRRYIPQAIAQGV
AAIIAEAKDEAHDGEIREMHGVPVIYLSQLNERLSALAGRFYHQPSEQLRLVGVTGTNGK
TTTTQLLAQWAQRLGETSAVMGTVGNGLLEKVIPTENTTGSAVDVQHVLSGLAGQGATFA
AMEVSSHGLVQHRVAALQFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSTHHCGQAIVN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCRGRWLKATAVSYHDSGATIQFASSWGNGEIE
SRLMGAFNVSNLLLALATLLALGYPLAELLKTAARLQPVCGRMEVFAAPGKPTVVVDYAH
TPDALEKALQAARLHCRGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEE
PRAIINDILAGMLDAGHARAVEGRAEAVTNAVMQAKENDVVLVAGKGHEDYQIVGNRRLD
YSDRVTVARLLGAVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttctcgctccgtgggtgccaaatgcgccggagcga
attctgcgagaaatgacgctggacagccgggtggctgcttctggcgatctttttatcgcg
gttttaggtcatcaggcggacgggcgtcgttatatcccgcaggcgatagcgcaaggtgtt
gctgccattattgctgaggccaaagatgaggcccatgacggcgaaatccgtgaaatgcac
ggtgtgccggttatctatctgagccaactcaacgagcgcttatccgcgctggccgggcgt
ttttaccatcagccttcggaacaactgcgcctggtgggcgtcaccgggactaacggcaag
accaccacgacacagctgctggcgcagtgggcgcagcggctgggggaaaccagcgcggta
atgggaaccgtaggcaatggcctgctggagaaagttatcccaacggaaaacaccaccggt
tcggccgttgatgttcaacacgtactctctggcctggcagggcagggggcgacgttcgcc
gcgatggaagtctcttcccacgggctggtgcagcatcgcgtagccgcgctgcagtttgcc
gcctcggtcttcaccaacctgagccgcgatcacctcgattaccacggtgatatggagcat
tacgaagcggcgaaatggctgctctactcaacccaccattgcgggcaggcgattgttaat
gcggacgatgaagtcggtcgccgctggctggcgaagctgccggatgcggtcgccgtatcg
atggaagatcacattaacccgaactgccggggccgctggctcaaagcgaccgccgtgagc
tatcacgatagcggcgccaccattcagtttgcctccagctgggggaacggcgagatcgaa
agccgcctgatgggcgcctttaacgtcagcaatctgctgctggccttagccaccctgctg
gcgctgggctatccgcttgccgaactgctgaaaaccgccgcgcgcctgcagccggtatgc
gggcgtatggaagtgttcgccgcgccgggtaaaccgaccgtggtcgttgattacgcccac
acgcctgatgcgctggaaaaagcgctgcaggcggcgcgtctgcactgtcgcggtaaactg
tggtgcgtatttggctgcggcggggatcgcgacaaaggcaagcgtccgctgatgggcgct
atcgccgaagagtttgccgatatcgtggttgtcaccgacgacaacccgcgcaccgaagag
ccgcgggcgattatcaatgacattctggccggcatgctggacgcgggccatgccagggcg
gtggaaggtcgtgcggaagcggtcactaatgcggtgatgcaggcgaaagaaaacgacgtc
gttctggtggcgggcaaaggccacgaggactatcaaatcgtcggcaatcgccgactcgat
tactctgaccgcgtcaccgtggcgcgtctgctgggggcggtagcatga

DBGET integrated database retrieval system