KEGG   Klebsiella oxytoca KCTC 1686: KOX_11465Help
Entry
KOX_11465         CDS       T01681                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kox  Klebsiella oxytoca KCTC 1686
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KOX_11465
Enzymes [BR:kox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KOX_11465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2468880..2470079
Genome map
AA seq 399 aa AA seqDB search
MKQLTILGSTGSIGCSTLDVVRHNPDSFSITALVAGKNVDRMVEQCLEFSPRYAVMDDAH
SAELLRAQLREQGCRTEVMSGQQAAAEVAALDEVEQVMAAIVGAAGLVPTLSAIRAGKTV
LLANKESLVTCGRLFMDAVQQYGARLLPVDSEHNAIFQSMPETIQHNLGYADLTQNGVAS
ILLTGSGGPFRETAISELAAMTPDRACKHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAQQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMGWPKRLNSGVKPLDFC
QLSTLSFSAPDYGRYPCLKLAMEAFDVGQAATTALNAANEVSVAAFLNGDIRFTDIAAIN
QAVLDQQALNEPQSIDEVLAIDAMARVSAGQLLTAWRKF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccattcttggttcgaccggttctatcggctgcagcacgctggatgtg
gtgcgccataatcctgatagcttttctatcaccgcgctggtcgccgggaaaaatgtcgac
cgtatggttgaacaatgtctggaattctcccctcgttacgcggtaatggacgatgcgcac
agcgcggagctgctgcgtgcgcaactgcgcgagcagggctgccgaacggaagtcatgagc
ggccagcaggcggcggcagaagtggcggcgctcgacgaggttgagcaggtgatggcggcg
attgtcggcgcagcaggcctggtgccgacgctctcagccattcgtgcgggtaaaacggtg
ctgctggcgaacaaagagtcgctggtgacctgcggccgtctgtttatggatgccgtgcag
cagtacggcgcacgattgttgccggttgatagcgagcataatgcgatttttcagagtatg
ccggaaacaattcaacataatctgggatacgctgatttaacccagaacggcgtggcgtcg
attctgctcactggctccggcggtcccttccgggaaacggcgatttctgaactggcggcg
atgacccccgatcgggcatgcaagcatccaaactggtcgatggggcgcaaaatatctgtc
gattcggccaccatgatgaacaaagggctggagtatatcgaagcccgctggctgttcaac
gcctcggcgcagcagatggaagtcctgatccatccgcaatcggtgattcactcgatggta
cgttatcaggatggcagcgtcctggcgcagctcggcgagccggatatgcgtacgccgatt
gcccacacgatgggctggccaaaacgccttaattctggcgtgaaaccgctggatttctgt
cagttgagcactctgagcttctcggcgccggattacggccgttacccctgcctgaagctg
gccatggaggcttttgatgtcggtcaggcggcgaccacggcgctgaatgcggcaaatgaa
gtttcagtcgcggcgtttctgaacggggatattcgctttaccgatattgcggcgataaat
caggcggtgctggatcaacaggcgttaaatgagccgcaaagtattgatgaagtgctggct
attgatgcgatggcccgggtaagcgcaggccagctcctgacggcgtggcgcaaattctga

  All links  
No link information was found.   
DBGET integrated database retrieval system